StarFunc result for job id Q9BZH6

User Input

>input (1224 residues)
MLPYTVNFKVSARTLTGALNAHNKAAVDWGWQGLIAYGCHSLVVVIDSITAQTLQVLEKH
KADVVKVKWARENYHHNIGSPYCLRLASADVNGKIIVWDVAAGVAQCEIQEHAKPIQDVQ
WLWNQDASRDLLLAIHPPNYIVLWNADTGTKLWKKSYADNILSFSFDPFDPSHLTLLTSE
GIVFISDFSPSKPPSGPGKKVYISSPHSSPAHNKLATATGAKKALNKVKILITQEKPSAE
FITLNDCLQLAYLPSKRNHMLLLYPREILILDLEVNQTVGVIAIERTGVPFLQVIPCFQR
DGLFCLHENGCITLRVRRSYNNIFTTSNEEPDPDPVQELTYDLRSQCDAIRVTKTVRPFS
MVCCPVNENAAALVVSDGRVMIWELKSAVCNRNSRNSSSGVSPLYSPVSFCGIPVGVLQN
KLPDLSLDNMIGQSAIAGEEHPRGSILREVHLKFLLTGLLSGLPAPQFAIRMCPPLTTKN
IKMYQPLLAVGTSNGSVLVYHLTSGLLHKELSIHSCEVKGIEWTSLTSFLSFATSTPNNM
GLVRNELQLVDLPTGRSIAFRGERGNDESAIEMIKVSHLKQYLAVVFRDKPLELWDVRTC
TLLREMSKNFPTITALEWSPSHNLKSLRKKQLATREAMARQTVVSDTELSIVESSVISLL
QEAESKSELSQNISAREHFVFTDIDGQVYHLTVEGNSVKDSARIPPDGSMGSITCIAWKG
DTLVLGDMDGNLNFWDLKGRVSRGIPTHRSWVRKIRFAPGKGNQKLIAMYNDGAEVWDTK
EVQMVSSLRSGRNVTFRILDVDWCTSDKVILASDDGCIRVLEMSMKSACFRMDEQELTEP
VWCPYLLVPRASLALKAFLLHQPWNGQYSLDISHVDYPENEEIKNLLQEQLNSLSNDIKK
LLLDPEFTLLQRCLLVSRLYGDESELHFWTVAAHYLHSLSQEKSASTTAPKEAAPRDKLS
NPLDICYDVLCENAYFQKFQLERVNLQEVKRSTYDHTRKCTDQLLLLGQTDRAVQLLLET
SADNQHYYCDSLKACLVTTVTSSGPSQSTIKLVATNMIANGKLAEGVQLLCLIDKAADAC
RYLQTYGEWNRAAWLAKVRLNPEECADVLRRWVDHLCSPQVNQKSKALLVLLSLGCFFSV
AETLHSMRYFDRAALFVEACLKYGAFEVTEDTEKLITAIYADYARSLKNLGFKQGAVLFA
SKAGAAGKDLLNELESPKEEPIEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RCJ6	0.974	0.974	0.000	1224	0.998	0.998	B2RCJ6.pdb.gz	B2RCJ6_HUMAN cDNA, FLJ96114, highly similar to Homo sapiens bromodomain and WD repeat domain containing 2 (BRWD2), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:F1QEB7	0.979	0.967	0.000	1239	0.761	0.752	F1QEB7.pdb.gz	WDR11_DANRE WD repeat-containing protein 11 OS=Danio rerio OX=7955 GN=wdr11 PE=2 SV=1
3	AFDB:P47104	0.267	0.247	1.814E-22	1357	0.130	0.117	P47104.pdb.gz	RAV1_YEAST Regulator of V-ATPase in vacuolar membrane protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAV1 PE=1 SV=1
4	AFDB:E9QH84	0.270	0.238	2.145E-22	1440	0.138	0.117	E9QH84.pdb.gz	E9QH84_DANRE Gem (nuclear organelle)-associated protein 5 OS=Danio rerio OX=7955 GN=gemin5 PE=1 SV=1
5	AFDB:Q8TEQ6	0.347	0.290	6.108E-22	1508	0.135	0.109	Q8TEQ6.pdb.gz	GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3
6	AFDB:G5EFW7	0.184	0.188	2.057E-21	1192	0.124	0.128	G5EFW7.pdb.gz	IF122_CAEEL Intraflagellar transport protein 122 homolog OS=Caenorhabditis elegans OX=6239 GN=daf-10 PE=1 SV=1
7	AFDB:Q38B65	0.187	0.184	4.191E-21	1242	0.120	0.118	Q38B65.pdb.gz	Q38B65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1660 PE=4 SV=1
8	AFDB:Q8BX17	0.346	0.290	8.190E-21	1502	0.142	0.116	Q8BX17.pdb.gz	GEMI5_MOUSE Gem-associated protein 5 OS=Mus musculus OX=10090 GN=Gemin5 PE=1 SV=2
9	AFDB:Q57ZX9	0.184	0.179	1.194E-20	1260	0.146	0.142	Q57ZX9.pdb.gz	Q57ZX9_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.80 PE=4 SV=1
10	AFDB:P87177	0.313	0.395	1.245E-20	922	0.122	0.162	P87177.pdb.gz	YB1C_SCHPO Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC3D6.12 PE=1 SV=1
11	PDB:7mqaLQ	0.348	0.482	4.145E-20	830	0.100	0.147	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7ajuUL	0.349	0.507	3.656E-19	779	0.109	0.172	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	PDB:7d5sB2	0.341	0.462	4.323E-19	851	0.112	0.161	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
14	PDB:7mq8LR	0.326	0.467	6.571E-19	773	0.093	0.147	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:1nr0A	0.365	0.662	2.844E-18	610	0.080	0.161	1nr0A.pdb.gz
16	PDB:6lqsB1	0.397	0.582	4.508E-18	806	0.083	0.127	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
17	PDB:7mq8LT	0.377	0.513	7.451E-18	869	0.098	0.138	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mqaLO	0.399	0.576	1.086E-17	819	0.100	0.150	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:5wyjBE	0.373	0.567	1.231E-17	753	0.088	0.143	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
20	PDB:7d4iBE	0.392	0.524	1.872E-17	890	0.100	0.137	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RCJ6	0.0	2534	1224	0.998	0.998	B2RCJ6_HUMAN cDNA, FLJ96114, highly similar to Homo sapiens bromodomain and WD repeat domain containing 2 (BRWD2), mRNA OS=Homo sapiens OX=9606 PE=2 SV=1
2	F1QEB7	0.0	1946	1239	0.765	0.755	WDR11_DANRE WD repeat-containing protein 11 OS=Danio rerio OX=7955 GN=wdr11 PE=2 SV=1
3	Q659C9	0.0	1558	753	0.615	1.000	Q659C9_HUMAN Uncharacterized protein DKFZp434L1715 OS=Homo sapiens OX=9606 GN=DKFZp434L1715 PE=2 SV=1
4	Q8K1X1	0.0	2381	1223	0.941	0.942	WDR11_MOUSE WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Wdr11 PE=1 SV=1
5	Q9BZH6	0.0	2537	1224	1.000	1.000	WDR11_HUMAN WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=WDR11 PE=1 SV=1
6	Q9NVU3	0.0	1781	864	0.704	0.998	Q9NVU3_HUMAN cDNA FLJ10506 fis, clone NT2RP2000510 OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q9NWV7	0.0	1072	515	0.421	1.000	Q9NWV7_HUMAN cDNA FLJ20572 fis, clone REC01048 OS=Homo sapiens OX=9606 PE=2 SV=1
8	S4R3Z0	0.0	648	312	0.255	1.000	S4R3Z0_HUMAN WD repeat domain 11 (Fragment) OS=Homo sapiens OX=9606 GN=WDR11 PE=1 SV=1
9	Q6NNP0	1.89e-05	51.2	509	0.032	0.077	ATG16_ARATH Autophagy-related protein 16 OS=Arabidopsis thaliana OX=3702 GN=ATG16 PE=1 SV=1
10	Q09649	9.20e-05	49.3	702	0.030	0.053	Q09649_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fzr-1 PE=1 SV=1
11	Q57W14	0.001	45.4	419	0.025	0.074	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
12	O18402	0.002	44.7	478	0.027	0.069	O18402_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=fzr PE=2 SV=1
13	Q9W4H9	0.002	44.7	478	0.027	0.069	Q9W4H9_DROME WD repeat-containing protein 55 homolog OS=Drosophila melanogaster OX=7227 GN=fzr PE=2 SV=1
14	Q9VPR4	0.004	43.9	488	0.038	0.096	NLE_DROME Protein Notchless OS=Drosophila melanogaster OX=7227 GN=Nle PE=1 SV=2
15	Q8VEJ4	0.008	42.7	485	0.053	0.134	NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus OX=10090 GN=Nle1 PE=1 SV=4
16	Q99KP6	0.011	42.4	504	0.044	0.107	PRP19_MOUSE Pre-mRNA-processing factor 19 OS=Mus musculus OX=10090 GN=Prpf19 PE=1 SV=1
17	Q9JMJ4	0.011	42.4	504	0.044	0.107	PRP19_RAT Pre-mRNA-processing factor 19 OS=Rattus norvegicus OX=10116 GN=Prpf19 PE=1 SV=2
18	O60907	0.014	42.0	577	0.023	0.049	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
19	Q9FN19	0.018	41.6	613	0.020	0.041	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
20	Q57ZX9	0.023	41.6	1260	0.036	0.035	Q57ZX9_TRYB2 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.80 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00033	32.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF01011 PQQ	54	15.0	PQQ enzyme repeat
3	PF14655 RAB3GAP2_N	75	13.9	Rab3 GTPase-activating protein regulatory subunit N-terminus
4	PF00400 WD40	0.016	27.3	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263461

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000464275	0.925	Protein Njmu-R1
2	9606.ENSP00000327821	0.840	Exportin-T
3	9606.ENSP00000367013	0.803	Tumor necrosis factor receptor superfamily member 25
4	9606.ENSP00000221132	0.769	Tumor necrosis factor receptor superfamily member 10A
5	9606.ENSP00000353099	0.707	HLA class II histocompatibility antigen, DRB1-15 beta chain
6	9606.ENSP00000345719	0.701	Torsin-1A
7	9606.ENSP00000367024	0.690	N-alpha-acetyltransferase 40
8	9606.ENSP00000223321	0.684	Proteasome subunit alpha type-2
9	9606.ENSP00000246548	0.681	SUMO-activating enzyme subunit 2
10	9606.ENSP00000258494	0.678	Mitochondrial 10-formyltetrahydrofolate dehydrogenase
11	9606.ENSP00000259339	0.664	Torsin-1B
12	9606.ENSP00000359170	0.628	Protein DPCD
13	9606.ENSP00000359149	0.622	F-box/WD repeat-containing protein 4
14	9606.ENSP00000359219	0.604	Kazal-type serine protease inhibitor domain-containing protein 1
15	9606.ENSP00000354850	0.588	Protein O-GlcNAcase
16	9606.ENSP00000044462	0.580	Proteasome subunit alpha type-4
17	9606.ENSP00000359181	0.574	DNA polymerase lambda
18	9606.ENSP00000296861	0.564	Tumor necrosis factor receptor superfamily member 21
19	9606.ENSP00000339398	0.561	Major histocompatibility complex, class II, DQ alpha 1
20	9606.ENSP00000379873	0.557	HLA class I histocompatibility antigen, A-3 alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0016043	0.953	cellular component organization
GO:0050789	0.910	regulation of biological process
GO:0050794	0.840	regulation of cellular process
GO:0051648	0.812	vesicle localization
GO:0006996	0.803	organelle organization
GO:0048856	0.792	anatomical structure development
GO:0051234	0.732	establishment of localization
GO:0051641	0.707	cellular localization
GO:0030030	0.696	cell projection organization
GO:0006810	0.618	transport
GO:0060271	0.564	cilium assembly
GO:0051650	0.524	establishment of vesicle localization
GO:0048513	0.481	animal organ development
GO:0048583	0.395	regulation of response to stimulus
GO:0016192	0.361	vesicle-mediated transport
GO:0006903	0.344	vesicle targeting
GO:0048518	0.343	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005634	0.991	nucleus
GO:0016020	0.989	membrane
GO:0031090	0.968	organelle membrane
GO:0043228	0.956	non-membrane-bounded organelle
GO:0043232	0.954	intracellular non-membrane-bounded organelle
GO:0098588	0.928	bounding membrane of organelle
GO:0005773	0.815	vacuole
GO:0070013	0.751	intracellular organelle lumen
GO:0005764	0.740	lysosome
GO:0005774	0.738	vacuolar membrane
GO:0005765	0.722	lysosomal membrane
GO:0005829	0.708	cytosol
GO:0005815	0.544	microtubule organizing center
GO:0012505	0.526	endomembrane system
GO:0031981	0.495	nuclear lumen
GO:0042995	0.374	cell projection
GO:0032991	0.352	protein-containing complex
GO:0031982	0.316	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]