StarFunc result for job id Q9BZI7

User Input

>input (483 residues)
MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPP
TLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFL
DNKGQEYPAIVEFAPFQKAAKKKTKKRDTKVGTIDDDPEYRKFLESYATDNEKMTSTPET
LLEEIEAKNRELIAKKTTPLLSFLKNKQRMREEKREERRRREIERKRQREEERRKWKEEE
KRKRKDIEKLKKIDRIPERDKLKDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKREK
AKKLDKENLSDERASGQSCTLPKRSDSELKDEKPKRPEDESGRDYREREREYERDQERIL
RERERLKRQEEERRRQKERYEKEKTFKRKEEEMKKEKDTLRDKGKKAESTESIGSSEKTE
KKEEVVKRDRIRNKDRPAMQLYQPGARSRNRLCPPDDSTKSGDSAAERKQESGISHRKEG
GEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BZI7	1.000	1.000	2.278E-73	483	1.000	1.000	Q9BZI7.pdb.gz	REN3B_HUMAN Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B PE=1 SV=1
2	AFDB:Q3ULL6	0.265	0.270	9.764E-58	472	0.845	0.864	Q3ULL6.pdb.gz	Q3ULL6_MOUSE UPF3 regulator of nonsense transcripts homolog B (yeast) OS=Mus musculus OX=10090 GN=Upf3b PE=1 SV=1
3	AFDB:F1QNX7	0.224	0.231	1.210E-36	467	0.545	0.563	F1QNX7.pdb.gz	REN3B_DANRE Regulator of nonsense transcripts 3B OS=Danio rerio OX=7955 GN=upf3b PE=2 SV=1
4	AFDB:B0S733	0.322	0.342	2.260E-35	452	0.453	0.485	B0S733.pdb.gz	REN3A_DANRE Regulator of nonsense transcripts 3A OS=Danio rerio OX=7955 GN=upf3a PE=1 SV=2
5	AFDB:Q9H1J1	0.272	0.275	5.655E-33	476	0.422	0.429	Q9H1J1.pdb.gz	REN3A_HUMAN Regulator of nonsense transcripts 3A OS=Homo sapiens OX=9606 GN=UPF3A PE=1 SV=1
6	AFDB:Q149I6	0.142	0.272	2.925E-20	248	0.433	0.843	Q149I6.pdb.gz	Q149I6_MOUSE Upf3b protein OS=Mus musculus OX=10090 GN=Upf3b PE=2 SV=1
7	AFDB:Q9W1H3	0.211	0.208	6.671E-19	492	0.273	0.268	Q9W1H3.pdb.gz	Q9W1H3_DROME FI21285p1 OS=Drosophila melanogaster OX=7227 GN=Upf3 PE=1 SV=2
8	AFDB:Q9FVW4	0.218	0.218	9.279E-14	482	0.178	0.178	Q9FVW4.pdb.gz	RENT3_ARATH Regulator of nonsense transcripts UPF3 OS=Arabidopsis thaliana OX=3702 GN=UPF3 PE=1 SV=1
9	AFDB:Q8WZK0	0.161	0.115	1.272E-6	695	0.168	0.117	Q8WZK0.pdb.gz	US107_SCHPO U1 snRNP-associated protein usp107 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp107 PE=1 SV=1
10	AFDB:Q802Z5	0.114	0.124	4.213E-6	441	0.120	0.132	Q802Z5.pdb.gz	Q802Z5_DANRE Non-POU domain-containing octamer-binding protein OS=Danio rerio OX=7955 GN=wu:fb40d10 PE=1 SV=1
11	PDB:3lqvB	0.146	0.529	5.327E-5	115	0.043	0.183	3lqvB.pdb.gz	Branch Recognition by SF3b14
12	PDB:6g90B	0.148	0.338	2.630E-4	193	0.035	0.088	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
13	PDB:7dvqY	0.150	0.462	3.432E-4	140	0.037	0.129	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:6qx91K	0.146	0.326	5.844E-4	201	0.029	0.070	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
15	PDB:6ff7X	0.157	0.404	6.675E-4	171	0.031	0.088	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	PDB:7dvqI	0.158	0.536	6.675E-4	128	0.035	0.133	7dvqI.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:6exnY	0.144	0.638	7.626E-4	87	0.035	0.195	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
18	PDB:5vsuA	0.149	0.184	1.388E-3	387	0.027	0.034	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
19	PDB:6qw6R	0.140	0.560	1.483E-3	106	0.017	0.075	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:7oqcF	0.132	0.222	1.811E-3	267	0.027	0.049	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3ULL6	0.0	622	472	0.826	0.845	Q3ULL6_MOUSE UPF3 regulator of nonsense transcripts homolog B (yeast) OS=Mus musculus OX=10090 GN=Upf3b PE=1 SV=1
2	Q9BZI7	0.0	954	483	1.000	1.000	REN3B_HUMAN Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B PE=1 SV=1
3	Q80UI8	7.83e-167	478	388	0.685	0.853	Q80UI8_MOUSE Upf3b protein (Fragment) OS=Mus musculus OX=10090 GN=Upf3b PE=2 SV=1
4	Q9CS15	7.60e-133	385	232	0.391	0.815	Q9CS15_MOUSE UPF3 domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Upf3b PE=2 SV=1
5	F1QNX7	6.74e-105	322	467	0.557	0.576	REN3B_DANRE Regulator of nonsense transcripts 3B OS=Danio rerio OX=7955 GN=upf3b PE=2 SV=1
6	F6Q8N5	1.34e-93	286	260	0.431	0.800	F6Q8N5_MOUSE UPF3 regulator of nonsense transcripts homolog B (yeast) (Fragment) OS=Mus musculus OX=10090 GN=Upf3b PE=1 SV=1
7	Q9H1J1	2.43e-90	285	476	0.422	0.429	REN3A_HUMAN Regulator of nonsense transcripts 3A OS=Homo sapiens OX=9606 GN=UPF3A PE=1 SV=1
8	B0S733	3.65e-79	255	452	0.251	0.268	REN3A_DANRE Regulator of nonsense transcripts 3A OS=Danio rerio OX=7955 GN=upf3a PE=1 SV=2
9	Q9CUH6	2.05e-74	236	248	0.232	0.452	Q9CUH6_MOUSE UPF3 domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Upf3a PE=2 SV=1
10	Q3ULJ3	4.32e-74	241	422	0.232	0.265	Q3ULJ3_MOUSE UPF3 regulator of nonsense transcripts homolog A (Yeast) OS=Mus musculus OX=10090 GN=Upf3a PE=1 SV=1
11	Q149I6	1.56e-65	213	248	0.199	0.387	Q149I6_MOUSE Upf3b protein OS=Mus musculus OX=10090 GN=Upf3b PE=2 SV=1
12	Q9CTQ4	2.63e-48	165	155	0.151	0.471	Q9CTQ4_MOUSE UPF3 domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Upf3a PE=2 SV=1
13	Q9W1H3	1.14e-33	134	492	0.143	0.140	Q9W1H3_DROME FI21285p1 OS=Drosophila melanogaster OX=7227 GN=Upf3 PE=1 SV=2
14	Q8T994	5.23e-33	132	450	0.143	0.153	Q8T994_DROME SD10857p OS=Drosophila melanogaster OX=7227 GN=Upf3 PE=2 SV=1
15	Q9FVW4	6.19e-23	103	482	0.122	0.122	RENT3_ARATH Regulator of nonsense transcripts UPF3 OS=Arabidopsis thaliana OX=3702 GN=UPF3 PE=1 SV=1
16	Q20445	4.20e-16	81.6	329	0.128	0.188	Q20445_CAEEL UPF3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-4 PE=1 SV=2
17	Q8WQF3	8.24e-16	81.3	368	0.137	0.179	Q8WQF3_CAEEL UPF3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=smg-4 PE=1 SV=2
18	Q10267	2.00e-09	60.8	278	0.093	0.162	UPF3_SCHPO Nonsense-mediated mRNA decay protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=upf3 PE=3 SV=1
19	P48412	0.001	43.5	387	0.072	0.090	UPF3_YEAST Nonsense-mediated mRNA decay protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UPF3 PE=1 SV=1
20	Q8SX83	0.62	35.4	5560	0.097	0.008	SPEN_DROME Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	24	16.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF03467 Smg4_UPF3	4.5e-50	181.6	Smg-4/UPF3 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010373348.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010364874.1	0.999	Regulator of nonsense transcripts 2 isoform X1
2	61622.XP_010370559.1	0.999	Mago homolog, exon junction complex core component
3	61622.XP_010372739.1	0.999	Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs.
4	61622.XP_010384971.1	0.998	UPF1, RNA helicase and ATPase
5	61622.XP_010352790.1	0.997	Cancer susceptibility candidate 3
6	61622.XP_010378022.1	0.997	Belongs to the DEAD box helicase family.
7	61622.XP_010358024.1	0.990	Protein mago nashi homolog 2-like
8	61622.XP_010369691.1	0.990	Mago homolog B, exon junction complex core component
9	61622.XP_010368728.1	0.973	SMG1, nonsense mediated mRNA decay associated PI3K related kinase
10	61622.XP_010380709.1	0.973	Serine/threonine-protein kinase SMG1-like isoform X1
11	61622.XP_010383162.1	0.954	Nuclear RNA export factor 1
12	61622.XP_010376136.1	0.951	PYM homolog 1, exon junction complex associated factor
13	61622.XP_010364404.1	0.936	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 3 bases in 2 codons
14	61622.XP_010386214.1	0.936	RNA-binding protein with serine-rich domain 1
15	61622.XP_010373123.1	0.929	UPF3 regulator of nonsense transcripts homolog A (yeast)
16	61622.XP_010355917.1	0.911	Nuclear RNA export factor 2
17	61622.XP_010381787.1	0.911	Nuclear RNA export factor 3
18	61622.XP_010387623.1	0.904	Zinc finger GRF-type containing 1
19	61622.XP_010352695.1	0.837	Aly/REF export factor
20	61622.XP_010352890.1	0.818	THO complex subunit 2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	1.000	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0000184	0.993	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0048522	0.968	positive regulation of cellular process
GO:0051171	0.924	regulation of nitrogen compound metabolic process
GO:0009893	0.919	positive regulation of metabolic process
GO:0031323	0.898	regulation of cellular metabolic process
GO:0080090	0.891	regulation of primary metabolic process
GO:0010604	0.860	positive regulation of macromolecule metabolic process
GO:0071840	0.537	cellular component organization or biogenesis
GO:0031326	0.531	regulation of cellular biosynthetic process
GO:0010556	0.528	regulation of macromolecule biosynthetic process
GO:0032501	0.511	multicellular organismal process
GO:0048856	0.505	anatomical structure development
GO:0051173	0.485	positive regulation of nitrogen compound metabolic process
GO:0031325	0.484	positive regulation of cellular metabolic process
GO:0016043	0.449	cellular component organization
GO:0007275	0.413	multicellular organism development
GO:0010628	0.394	positive regulation of gene expression
GO:0010608	0.380	post-transcriptional regulation of gene expression
GO:0051246	0.371	regulation of protein metabolic process
GO:2000112	0.371	regulation of cellular macromolecule biosynthetic process
GO:0006417	0.360	regulation of translation
GO:0045597	0.325	positive regulation of cell differentiation
GO:0010467	0.312	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0031981	0.996	nuclear lumen
GO:0005654	0.992	nucleoplasm
GO:0140513	0.954	nuclear protein-containing complex
GO:0005737	0.942	cytoplasm
GO:0005829	0.909	cytosol
GO:0043232	0.807	intracellular non-membrane-bounded organelle
GO:0035145	0.662	exon-exon junction complex
GO:0005730	0.650	nucleolus
GO:0005856	0.489	cytoskeleton
GO:0015630	0.368	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]