StarFunc result for job id Q9BZK3

User Input

>input (213 residues)
MPGEATETVPAIEQQLLQPQAETGSGTESDSDESVPELEEQDSTQVTAQVQLVVAAEIDE
EPVSKAKQRRSEKKARKARFKLGLQQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYM
VFGEAKIEDLSQEAQLAAAEKFKVQGEAVSNIQENTQTPTVQEGSEDEEVDETGVEIKDI
ELVLSQANVWGAKAVRALKNSNDIVNAIMELTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8JIU7	0.557	0.552	5.517E-29	215	0.873	0.865	Q8JIU7.pdb.gz	NACA_DANRE Nascent polypeptide-associated complex subunit alpha OS=Danio rerio OX=7955 GN=naca PE=1 SV=1
2	AFDB:P70670	0.424	0.058	9.586E-26	2187	0.826	0.080	P70670.pdb.gz	NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus OX=10090 GN=Naca PE=1 SV=2
3	AFDB:Q94518	0.572	0.564	1.501E-20	217	0.563	0.553	Q94518.pdb.gz	NACA_DROME Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster OX=7227 GN=Nacalpha PE=1 SV=2
4	AFDB:O15069	0.383	0.077	8.970E-20	1562	0.601	0.082	O15069.pdb.gz	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
5	AFDB:Q86S66	0.328	0.357	4.362E-18	195	0.474	0.518	Q86S66.pdb.gz	NACA_CAEEL Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans OX=6239 GN=icd-2 PE=1 SV=2
6	AFDB:Q94JX9	0.394	0.388	5.937E-18	217	0.451	0.442	Q94JX9.pdb.gz	NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At3g49470 PE=2 SV=2
7	AFDB:Q6ICZ8	0.379	0.395	8.595E-18	204	0.432	0.451	Q6ICZ8.pdb.gz	NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1
8	AFDB:Q9LHG9	0.386	0.404	1.170E-17	203	0.441	0.463	Q9LHG9.pdb.gz	NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1
9	AFDB:Q8LGC6	0.349	0.355	5.464E-17	209	0.408	0.416	Q8LGC6.pdb.gz	NACA5_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g33040 PE=2 SV=2
10	AFDB:Q9SZY1	0.353	0.355	7.438E-17	212	0.427	0.429	Q9SZY1.pdb.gz	NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1
11	PDB:7qwrt	0.300	0.909	1.336E-8	67	0.286	0.910	7qwrt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
12	PDB:7qwqt	0.203	0.796	2.517E-3	47	0.197	0.894	7qwqt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
13	PDB:7av6A	0.110	0.190	2.132E-1	99	0.042	0.091	7av6A.pdb.gz
14	PDB:7r04A	0.093	0.021	2.902E-1	2326	0.075	0.007	7r04A.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
15	PDB:5yzgY	0.086	0.089	3.491E-1	204	0.052	0.054	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
16	PDB:6c95D	0.191	0.407	3.491E-1	95	0.070	0.158	6c95D.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
17	PDB:2dsbA	0.094	0.097	4.468E-1	206	0.023	0.024	2dsbA.pdb.gz
18	PDB:5j0nF	0.106	0.072	4.752E-1	356	0.047	0.028	5j0nF.pdb.gz	Structure of a Holliday junction complex reveals mechanisms governing a highly regulated DNA transaction.
19	PDB:3j79V	0.093	0.125	5.717E-1	155	0.038	0.052	3j79V.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
20	PDB:6zqgJD	0.090	0.034	7.317E-1	829	0.061	0.016	6zqgJD.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13765	2.62e-117	334	215	0.897	0.888	NACA_HUMAN Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1
2	Q60817	2.62e-117	334	215	0.892	0.884	NACA_MOUSE Nascent polypeptide-associated complex subunit alpha OS=Mus musculus OX=10090 GN=Naca PE=1 SV=1
3	Q8JIU7	3.14e-113	324	215	0.859	0.851	NACA_DANRE Nascent polypeptide-associated complex subunit alpha OS=Danio rerio OX=7955 GN=naca PE=1 SV=1
4	P70670	1.47e-98	315	2187	0.826	0.080	NACAM_MOUSE Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Mus musculus OX=10090 GN=Naca PE=1 SV=2
5	O15069	1.29e-62	212	1562	0.582	0.079	NACAD_HUMAN NAC-alpha domain-containing protein 1 OS=Homo sapiens OX=9606 GN=NACAD PE=1 SV=3
6	Q94518	1.67e-56	180	217	0.479	0.470	NACA_DROME Nascent polypeptide-associated complex subunit alpha OS=Drosophila melanogaster OX=7227 GN=Nacalpha PE=1 SV=2
7	Q86S66	3.95e-52	168	195	0.502	0.549	NACA_CAEEL Nascent polypeptide-associated complex subunit alpha OS=Caenorhabditis elegans OX=6239 GN=icd-2 PE=1 SV=2
8	Q9LHG9	8.28e-47	155	203	0.437	0.458	NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1
9	Q94JX9	2.34e-46	154	217	0.394	0.387	NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At3g49470 PE=2 SV=2
10	Q9SZY1	4.36e-46	153	212	0.413	0.415	NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1
11	Q6ICZ8	1.29e-44	149	204	0.404	0.422	NACA3_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1
12	Q8LGC6	1.12e-43	147	209	0.394	0.402	NACA5_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g33040 PE=2 SV=2
13	P87147	2.19e-30	112	173	0.324	0.399	NACA_SCHPO Nascent polypeptide-associated complex subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=egd2 PE=1 SV=1
14	Q9VPV7	3.86e-27	107	347	0.390	0.239	Q9VPV7_DROME GH09281p OS=Drosophila melanogaster OX=7227 GN=gNacalpha PE=2 SV=2
15	Q6FJD5	1.25e-22	91.7	165	0.286	0.370	NACA_CANGA Nascent polypeptide-associated complex subunit alpha OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EGD2 PE=3 SV=1
16	Q38EE8	8.92e-22	90.1	188	0.300	0.340	Q38EE8_TRYB2 Nascent polypeptide associated complex subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0120 PE=4 SV=1
17	Q5ANP2	1.42e-21	89.4	178	0.296	0.354	NACA_CANAL Nascent polypeptide-associated complex subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EGD2 PE=3 SV=1
18	P38879	2.45e-19	83.6	174	0.286	0.351	NACA_YEAST Nascent polypeptide-associated complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGD2 PE=1 SV=3
19	O35242	0.93	32.7	920	0.108	0.025	FAN_MOUSE Protein FAN OS=Mus musculus OX=10090 GN=Nsmaf PE=1 SV=2
20	Q5XGK2	0.97	32.0	162	0.070	0.093	Q5XGK2_XENLA Transcription factor BTF3 OS=Xenopus laevis OX=8355 GN=btf3.S PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17669 DUF5529	5.1e+02	11.8	Family of unknown function (DUF5529)
2	PF19026 HYPK_UBA	0.1	23.3	HYPK UBA domain
3	PF01849 NAC	5.8e-17	72.8	NAC domain
4	PF12136 RNA_pol_Rpo13	38	15.6	RNA polymerase Rpo13 subunit HTH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008973438.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008974536.1	0.915	Transcription factor BTF3 homolog 4 isoform X1
2	9597.XP_008969285.1	0.808	JunD proto-oncogene, AP-1 transcription factor subunit
3	9597.XP_003810526.1	0.807	Belongs to the NAC-beta family.
4	9597.XP_008948796.1	0.807	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
5	9597.XP_003832934.1	0.756	Bardet-Biedl syndrome 10
6	9597.XP_008970795.1	0.737	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 63% coverage of the annotated genomic feature by RNAseq alignments
7	9597.XP_008950805.1	0.736	Belongs to the universal ribosomal protein uL22 family.
8	9597.XP_003808104.1	0.718	Ribosomal protein L35
9	9597.XP_003828045.1	0.697	60S ribosomal protein L4
10	9597.XP_003814375.1	0.686	Belongs to the universal ribosomal protein uL13 family.
11	9597.XP_003831370.1	0.685	60S ribosomal protein L7 isoform X1
12	9597.XP_003821977.1	0.678	60S ribosomal protein L24
13	9597.XP_003806493.1	0.670	Ribosomal protein L35a
14	9597.XP_003814749.1	0.668	Belongs to the universal ribosomal protein uS3 family.
15	9597.XP_003828658.1	0.655	Ubiquitin-like protein fubi and ribosomal protein S30
16	9597.XP_003826297.1	0.642	Ribosomal protein L32
17	9597.XP_008963519.1	0.642	Belongs to the eukaryotic ribosomal protein eS8 family.
18	9597.XP_003820835.1	0.641	Belongs to the EF-1-beta/EF-1-delta family.
19	9597.XP_003819444.1	0.640	Ribosomal protein L8
20	9597.XP_003820076.1	0.637	Belongs to the eukaryotic ribosomal protein eS25 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0071840	0.677	cellular component organization or biogenesis
GO:0016043	0.629	cellular component organization
GO:0050789	0.526	regulation of biological process
GO:0044085	0.512	cellular component biogenesis
GO:0022607	0.387	cellular component assembly
GO:0051179	0.351	localization
GO:0008152	0.347	metabolic process
GO:0071704	0.339	organic substance metabolic process
GO:0051641	0.333	cellular localization
GO:0050794	0.314	regulation of cellular process
GO:0044237	0.313	cellular metabolic process
GO:0044238	0.310	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.996	membrane-bounded organelle
GO:0005634	0.955	nucleus
GO:0043232	0.912	intracellular non-membrane-bounded organelle
GO:0005829	0.768	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]