StarFunc result for job id Q9BZK7

User Input

>input (514 residues)
MSISSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGALVPPAALISIIQKGLQYV
EAEVSINEDGTLFDGRPIESLSLIDAVMPDVVQTRQQAYRDKLAQQQAAAAAAAAAAASQ
QGSAKNGENTANGEENGAHTIANNHTDMMEVDGDVEIPPNKAVVLRGHESEVFICAWNPV
SDLLASGSGDSTARIWNLSENSTSGSTQLVLRHCIREGGQDVPSNKDVTSLDWNSEGTLL
ATGSYDGFARIWTKDGNLASTLGQHKGPIFALKWNKKGNFILSAGVDKTTIIWDAHTGEA
KQQFPFHSAPALDVDWQSNNTFASCSTDMCIHVCKLGQDRPIKTFQGHTNEVNAIKWDPT
GNLLASCSDDMTLKIWSMKQDNCVHDLQAHNKEIYTIKWSPTGPGTNNPNANLMLASASF
DSTVRLWDVDRGICIHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQTGALVHSY
RGTGGIFEVCWNAAGDKVGASASDGSVCVLDLRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BHJ5	0.816	0.816	2.581E-93	514	0.990	0.990	Q8BHJ5.pdb.gz	TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus OX=10090 GN=Tbl1xr1 PE=1 SV=1
2	AFDB:O60907	0.739	0.660	8.979E-90	577	0.887	0.790	O60907.pdb.gz	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
3	AFDB:Q95RJ9	0.724	0.533	6.789E-74	700	0.728	0.534	Q95RJ9.pdb.gz	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
4	AFDB:Q9FN19	0.690	0.581	8.211E-62	613	0.521	0.437	Q9FN19.pdb.gz	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
5	AFDB:P38262	0.584	0.562	2.425E-33	535	0.257	0.247	P38262.pdb.gz	SIF2_YEAST SIR4-interacting protein SIF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIF2 PE=1 SV=2
6	AFDB:O74845	0.614	0.563	4.044E-31	564	0.226	0.206	O74845.pdb.gz	HIF2_SCHPO Set3 complex subunit hif2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hif2 PE=1 SV=1
7	AFDB:Q9VPR4	0.604	0.635	1.407E-27	488	0.202	0.213	Q9VPR4.pdb.gz	NLE_DROME Protein Notchless OS=Drosophila melanogaster OX=7227 GN=Nle PE=1 SV=2
8	AFDB:Q3Y8L7	0.609	0.699	2.397E-27	446	0.183	0.211	Q3Y8L7.pdb.gz	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
9	AFDB:Q8RXQ4	0.609	0.764	3.301E-27	407	0.167	0.211	Q8RXQ4.pdb.gz	Q8RXQ4_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At1g71840 PE=1 SV=1
10	AFDB:Q1LV15	0.600	0.739	3.482E-27	415	0.161	0.200	Q1LV15.pdb.gz	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
11	PDB:5mzhB	0.600	0.737	1.035E-26	415	0.179	0.222	5mzhB.pdb.gz
12	PDB:5nnzA	0.590	0.888	4.269E-24	335	0.175	0.269	5nnzA.pdb.gz
13	PDB:7bt6x	0.592	0.623	8.536E-24	488	0.189	0.199	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
14	PDB:1vyhC	0.475	0.747	5.513E-23	310	0.158	0.261	1vyhC.pdb.gz
15	PDB:4v7fq	0.594	0.686	5.815E-23	443	0.183	0.212	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
16	PDB:5jcsq	0.600	0.631	1.034E-21	488	0.195	0.205	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
17	PDB:2h9lA	0.480	0.739	5.115E-21	321	0.163	0.262	2h9lA.pdb.gz
18	PDB:3jcmB	0.490	0.580	1.079E-20	429	0.128	0.154	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
19	PDB:7mqaLO	0.409	0.261	1.138E-20	819	0.154	0.096	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7mq8LR	0.485	0.331	1.408E-20	773	0.146	0.097	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60907	0.0	930	577	0.883	0.787	TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens OX=9606 GN=TBL1X PE=1 SV=3
2	Q8BHJ5	0.0	1057	514	0.990	0.990	TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus OX=10090 GN=Tbl1xr1 PE=1 SV=1
3	Q95RJ9	0.0	639	700	0.580	0.426	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
4	Q9BQ87	0.0	914	522	0.860	0.847	TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens OX=9606 GN=TBL1Y PE=1 SV=1
5	Q9BZK7	0.0	1068	514	1.000	1.000	TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens OX=9606 GN=TBL1XR1 PE=1 SV=1
6	Q9QXE7	0.0	940	527	0.903	0.880	TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus OX=10090 GN=Tbl1x PE=1 SV=2
7	Q9FN19	7.99e-158	464	613	0.420	0.352	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1
8	P38262	2.43e-46	171	535	0.272	0.262	SIF2_YEAST SIR4-interacting protein SIF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIF2 PE=1 SV=2
9	Q3Y8L7	4.47e-35	138	446	0.175	0.202	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
10	Q8N136	5.38e-34	135	415	0.177	0.219	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
11	Q9D4T2	8.84e-34	131	304	0.171	0.289	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
12	D3Z7A5	4.40e-33	132	415	0.171	0.212	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
13	Q57W14	2.47e-32	130	419	0.167	0.205	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
14	Q8TC44	5.96e-32	130	478	0.163	0.176	POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens OX=9606 GN=POC1B PE=1 SV=1
15	O74845	2.17e-31	129	564	0.245	0.223	HIF2_SCHPO Set3 complex subunit hif2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hif2 PE=1 SV=1
16	O74855	2.44e-31	129	502	0.208	0.213	NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsa4 PE=3 SV=1
17	Q1LV15	1.12e-30	125	415	0.169	0.210	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
18	Q99KN2	2.60e-30	123	339	0.161	0.245	CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus OX=10090 GN=Ciao1 PE=1 SV=1
19	O76071	3.53e-30	122	339	0.161	0.245	CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens OX=9606 GN=CIAO1 PE=1 SV=1
20	A0A0A0MRH0	1.10e-29	123	443	0.191	0.221	A0A0A0MRH0_HUMAN Notchless protein homolog 1 OS=Homo sapiens OX=9606 GN=NLE1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	4.7e-26	102.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF04053 Coatomer_WDAD	0.1	23.3	Coatomer WD associated region
3	PF08662 eIF2A	2.3e-08	45.7	Eukaryotic translation initiation factor eIF2A
4	PF16529 Ge1_WD40	0.84	20.2	WD40 region of Ge1, enhancer of mRNA-decapping protein
5	PF00457 Glyco_hydro_11	3e+02	12.4	Glycosyl hydrolases family 11
6	PF04762 IKI3	2.5e+02	11.0	IKI3 family
7	PF07941 K_channel_TID	2e+02	13.8	Potassium channel Kv1.4 tandem inactivation domain
8	PF08513 LisH	3.3e-06	38.1	LisH
9	PF20426 NBCH_WD40	2.9e-11	54.4	Neurobeachin beta propeller domain
10	PF11715 Nup160	2.4e+02	11.8	Nucleoporin Nup120/160
11	PF07676 PD40	1.3e+02	13.9	WD40-like Beta Propeller Repeat
12	PF00400 WD40	1.2e-49	176.4	WD domain, G-beta repeat
13	PF17005 WD40_like	0.49	21.3	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000006837

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000006991	0.985	Catenin beta 1
2	61853.ENSNLEP00000017988	0.984	Nuclear receptor corepressor 1
3	61853.ENSNLEP00000010715	0.981	Transducin (beta)-like 1X-linked
4	61853.ENSNLEP00000002872	0.961	Nuclear receptor corepressor 2
5	61853.ENSNLEP00000011036	0.957	Lysine (K)-specific methyltransferase 2E
6	61853.ENSNLEP00000011707	0.953	Histone deacetylase 3
7	61853.ENSNLEP00000016712	0.939	Methyl CpG binding protein 2
8	61853.ENSNLEP00000011414	0.934	G protein pathway suppressor 2
9	61853.ENSNLEP00000012898	0.913	Peptidyl-prolyl cis-trans isomerase
10	61853.ENSNLEP00000009838	0.905	Belongs to the SKP1 family.
11	61853.ENSNLEP00000003167	0.880	Histone deacetylase 1
12	61853.ENSNLEP00000015855	0.853	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
13	61853.ENSNLEP00000000487	0.838	T-box 2
14	61853.ENSNLEP00000000497	0.837	T-box 4
15	61853.ENSNLEP00000024353	0.811	APC, WNT signaling pathway regulator
16	61853.ENSNLEP00000022018	0.795	Histone deacetylase 8
17	61853.ENSNLEP00000019295	0.772	Transcription factor 7-like 2 (T-cell specific, HMG-box)
18	61853.ENSNLEP00000014593	0.771	Sirtuin 1
19	61853.ENSNLEP00000001479	0.765	Ankyrin repeat domain 28
20	61853.ENSNLEP00000011525	0.765	Ankyrin repeat domain 50

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000976	0.999	transcription cis-regulatory region binding
GO:0003714	0.998	transcription corepressor activity
GO:0042393	0.455	histone binding
GO:0008013	0.428	beta-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0009987	0.982	cellular process
GO:0048522	0.980	positive regulation of cellular process
GO:0009893	0.896	positive regulation of metabolic process
GO:0048523	0.893	negative regulation of cellular process
GO:0010604	0.886	positive regulation of macromolecule metabolic process
GO:0006357	0.884	regulation of transcription by RNA polymerase II
GO:0051173	0.863	positive regulation of nitrogen compound metabolic process
GO:1902680	0.846	positive regulation of RNA biosynthetic process
GO:0008152	0.842	metabolic process
GO:0071704	0.829	organic substance metabolic process
GO:0045893	0.807	positive regulation of DNA-templated transcription
GO:0010646	0.805	regulation of cell communication
GO:0044238	0.803	primary metabolic process
GO:0009966	0.797	regulation of signal transduction
GO:0045944	0.773	positive regulation of transcription by RNA polymerase II
GO:0031324	0.691	negative regulation of cellular metabolic process
GO:0051172	0.683	negative regulation of nitrogen compound metabolic process
GO:0010605	0.680	negative regulation of macromolecule metabolic process
GO:0031327	0.675	negative regulation of cellular biosynthetic process
GO:0051253	0.662	negative regulation of RNA metabolic process
GO:0010558	0.661	negative regulation of macromolecule biosynthetic process
GO:0045892	0.650	negative regulation of DNA-templated transcription
GO:0050896	0.645	response to stimulus
GO:0030111	0.595	regulation of Wnt signaling pathway
GO:0006807	0.591	nitrogen compound metabolic process
GO:0043170	0.542	macromolecule metabolic process
GO:0044237	0.519	cellular metabolic process
GO:1901564	0.478	organonitrogen compound metabolic process
GO:0032501	0.380	multicellular organismal process
GO:0060828	0.344	regulation of canonical Wnt signaling pathway
GO:0030177	0.334	positive regulation of Wnt signaling pathway
GO:0019538	0.329	protein metabolic process
GO:0032502	0.313	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.949	protein-containing complex
GO:0043232	0.441	intracellular non-membrane-bounded organelle
GO:0140513	0.378	nuclear protein-containing complex
GO:0005667	0.300	transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]