StarFunc result for job id Q9BZL6

User Input

>input (878 residues)
MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLL
PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSSSSS
SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALH
ASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGE
MPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQ
ENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA
ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV
ALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGA
IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BZL6	1.000	1.000	0.000	878	1.000	1.000	Q9BZL6.pdb.gz	KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2 PE=1 SV=3
2	AFDB:X1WHC7	0.597	0.592	0.000	886	0.691	0.685	X1WHC7.pdb.gz	X1WHC7_DANRE Serine/threonine-protein kinase OS=Danio rerio OX=7955 GN=prkd1 PE=3 SV=1
3	AFDB:D4A229	0.524	0.517	9.758E-104	890	0.659	0.651	D4A229.pdb.gz	D4A229_RAT Serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Prkd3 PE=1 SV=1
4	AFDB:O45818	0.516	0.430	2.412E-88	1070	0.484	0.397	O45818.pdb.gz	DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans OX=6239 GN=dkf-2 PE=1 SV=4
5	AFDB:A0A2R8RW52	0.505	0.772	5.402E-71	562	0.495	0.774	A0A2R8RW52.pdb.gz
6	PDB:5u6yA	0.283	0.534	8.152E-23	459	0.112	0.214	5u6yA.pdb.gz
7	AFDB:Q13557	0.284	0.493	8.274E-23	499	0.114	0.200	Q13557.pdb.gz	KCC2D_HUMAN Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D PE=1 SV=3
8	AFDB:E9QHI3	0.288	0.550	4.174E-22	453	0.113	0.219	E9QHI3.pdb.gz	E9QHI3_DANRE Death-associated protein kinase 3 OS=Danio rerio OX=7955 GN=dapk3 PE=3 SV=1
9	AFDB:A0A024R603	0.292	0.673	4.618E-22	370	0.112	0.265	A0A024R603.pdb.gz
10	AFDB:P15791	0.289	0.470	4.618E-22	533	0.114	0.188	P15791.pdb.gz	KCC2D_RAT Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Rattus norvegicus OX=10116 GN=Camk2d PE=1 SV=1
11	AFDB:O54784	0.290	0.558	5.110E-22	448	0.109	0.214	O54784.pdb.gz	DAPK3_MOUSE Death-associated protein kinase 3 OS=Mus musculus OX=10090 GN=Dapk3 PE=1 SV=1
12	PDB:2yaaA	0.292	0.825	3.805E-21	300	0.107	0.313	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
13	PDB:6b1uA	0.282	0.550	3.805E-21	442	0.114	0.226	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
14	PDB:5ufuA	0.281	0.650	8.990E-21	369	0.107	0.255	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
15	PDB:7myjC	0.281	0.517	1.218E-20	465	0.118	0.224	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
16	PDB:4zhxA	0.281	0.590	1.568E-20	409	0.109	0.235	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
17	PDB:3pfqA	0.284	0.468	1.526E-19	523	0.150	0.252	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
18	PDB:4rerA	0.280	0.528	5.979E-19	459	0.105	0.200	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
19	PDB:4rewA	0.289	0.602	8.518E-19	411	0.121	0.258	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:6s9wA	0.257	0.516	1.644E-18	411	0.117	0.251	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHC3	0.0	607	906	0.343	0.332	A0A0B4KHC3_DROME Serine/threonine-protein kinase OS=Drosophila melanogaster OX=7227 GN=PKD PE=3 SV=1
2	D4A229	0.0	1147	890	0.647	0.638	D4A229_RAT Serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Prkd3 PE=1 SV=1
3	F8WBA3	0.0	1243	920	0.707	0.675	F8WBA3_HUMAN Serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PRKD1 PE=1 SV=1
4	O45818	0.0	808	1070	0.490	0.402	DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans OX=6239 GN=dkf-2 PE=1 SV=4
5	O94806	0.0	1147	890	0.639	0.630	KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens OX=9606 GN=PRKD3 PE=1 SV=1
6	Q15139	0.0	1243	912	0.707	0.681	KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens OX=9606 GN=PRKD1 PE=1 SV=2
7	Q62101	0.0	1224	918	0.690	0.660	KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus OX=10090 GN=Prkd1 PE=1 SV=2
8	Q8BZ03	0.0	1642	875	0.952	0.955	KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus OX=10090 GN=Prkd2 PE=1 SV=1
9	Q9BZL6	0.0	1821	878	1.000	1.000	KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2 PE=1 SV=3
10	Q9VE91	0.0	607	836	0.344	0.361	Q9VE91_DROME Serine/threonine-protein kinase OS=Drosophila melanogaster OX=7227 GN=PKD PE=2 SV=4
11	Q9WTQ1	0.0	1213	918	0.691	0.661	KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus OX=10116 GN=Prkd1 PE=1 SV=2
12	X1WHC7	0.0	1211	886	0.692	0.686	X1WHC7_DANRE Serine/threonine-protein kinase OS=Danio rerio OX=7955 GN=prkd1 PE=3 SV=1
13	Q9XUJ7	7.83e-168	507	722	0.355	0.432	DKF1_CAEEL Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis elegans OX=6239 GN=dkf-1 PE=1 SV=1
14	P25323	1.41e-58	204	295	0.125	0.373	MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2
15	O96017	9.64e-52	192	543	0.122	0.197	CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=1
16	Q9Z265	3.54e-51	191	546	0.121	0.194	CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus OX=10090 GN=Chek2 PE=1 SV=1
17	Q8BW96	5.00e-51	186	385	0.115	0.262	KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2
18	Q8IU85	1.32e-50	185	385	0.115	0.262	KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D PE=1 SV=1
19	E7F1H0	1.92e-50	184	382	0.115	0.264	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1
20	Q8BWQ5	2.65e-50	192	790	0.122	0.135	DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus OX=10090 GN=Dclk3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.0012	29.6	ABC1 atypical kinase-like domain
2	PF01636 APH	3.4e+02	12.5	Phosphotransferase enzyme family
3	PF00130 C1_1	7e-24	94.8	Phorbol esters/diacylglycerol binding domain (C1 domain)
4	PF03107 C1_2	0.00049	31.7	C1 domain
5	PF06293 Kdo	0.16	22.9	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	0.49	21.3	Kinase-like
7	PF00069 Pkinase	5.4e-66	234.2	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	5.8e-29	112.7	Protein tyrosine and serine/threonine kinase
9	PF13901 zf-RING_9	10	17.5	Putative zinc-RING and/or ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393978

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369862	0.927	Collagen type IV alpha-3-binding protein
2	9606.ENSP00000368356	0.853	Serine/threonine-protein kinase D3
3	9606.ENSP00000408695	0.821	Protein kinase C alpha type
4	9606.ENSP00000263431	0.819	Protein kinase C gamma type
5	9606.ENSP00000305355	0.818	Protein kinase C beta type
6	9606.ENSP00000333568	0.803	Serine/threonine-protein kinase D1
7	9606.ENSP00000250559	0.802	Ras-related protein Rap-1b
8	9606.ENSP00000358723	0.800	Ras-related protein Rap-1A
9	9606.ENSP00000080059	0.681	Histone deacetylase 7
10	9606.ENSP00000379350	0.676	Integrin beta-1
11	9606.ENSP00000380948	0.659	Integrin beta-2
12	9606.ENSP00000329140	0.621	Cyclic AMP-responsive element-binding protein 3-like protein 2
13	9606.ENSP00000387699	0.618	Cyclic AMP-responsive element-binding protein 1
14	9606.ENSP00000349252	0.616	Integrin alpha-L
15	9606.ENSP00000262053	0.609	Cyclic AMP-dependent transcription factor ATF-1
16	9606.ENSP00000364349	0.608	Cyclic AMP-dependent transcription factor ATF-6 beta
17	9606.ENSP00000264110	0.603	Cyclic AMP-dependent transcription factor ATF-2
18	9606.ENSP00000078445	0.600	Cyclic AMP-responsive element-binding protein 3-like protein 3
19	9606.ENSP00000336790	0.600	Cyclic AMP-dependent transcription factor ATF-4
20	9606.ENSP00000342136	0.600	Cyclic AMP-responsive element-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0004697	0.958	protein kinase C activity
GO:0019899	0.843	enzyme binding
GO:0019900	0.670	kinase binding
GO:0019901	0.647	protein kinase binding
GO:0005080	0.422	protein kinase C binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.983	response to stimulus
GO:0036211	0.967	protein modification process
GO:0019222	0.960	regulation of metabolic process
GO:0048522	0.946	positive regulation of cellular process
GO:0060255	0.921	regulation of macromolecule metabolic process
GO:0031323	0.909	regulation of cellular metabolic process
GO:0080090	0.906	regulation of primary metabolic process
GO:0051171	0.903	regulation of nitrogen compound metabolic process
GO:0006468	0.876	protein phosphorylation
GO:0009893	0.823	positive regulation of metabolic process
GO:0048583	0.809	regulation of response to stimulus
GO:0051239	0.800	regulation of multicellular organismal process
GO:0010604	0.765	positive regulation of macromolecule metabolic process
GO:0009966	0.765	regulation of signal transduction
GO:0051716	0.747	cellular response to stimulus
GO:0031325	0.742	positive regulation of cellular metabolic process
GO:0048584	0.741	positive regulation of response to stimulus
GO:0023052	0.721	signaling
GO:0035556	0.711	intracellular signal transduction
GO:0010468	0.710	regulation of gene expression
GO:0030334	0.676	regulation of cell migration
GO:1902531	0.666	regulation of intracellular signal transduction
GO:0018193	0.651	peptidyl-amino acid modification
GO:0051173	0.642	positive regulation of nitrogen compound metabolic process
GO:0019219	0.605	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.601	regulation of macromolecule biosynthetic process
GO:0031326	0.601	regulation of cellular biosynthetic process
GO:0030335	0.598	positive regulation of cell migration
GO:0010594	0.592	regulation of endothelial cell migration
GO:0045935	0.572	positive regulation of nucleobase-containing compound metabolic process
GO:0051252	0.524	regulation of RNA metabolic process
GO:0009891	0.512	positive regulation of biosynthetic process
GO:0010634	0.511	positive regulation of epithelial cell migration
GO:0050793	0.502	regulation of developmental process
GO:0010595	0.500	positive regulation of endothelial cell migration
GO:0006355	0.483	regulation of DNA-templated transcription
GO:0042127	0.466	regulation of cell population proliferation
GO:0051246	0.464	regulation of protein metabolic process
GO:0048519	0.461	negative regulation of biological process
GO:0048523	0.441	negative regulation of cellular process
GO:0009967	0.430	positive regulation of signal transduction
GO:0018210	0.428	peptidyl-threonine modification
GO:0043535	0.422	regulation of blood vessel endothelial cell migration
GO:0010557	0.403	positive regulation of macromolecule biosynthetic process
GO:0031328	0.397	positive regulation of cellular biosynthetic process
GO:0002682	0.380	regulation of immune system process
GO:0051240	0.371	positive regulation of multicellular organismal process
GO:0065009	0.363	regulation of molecular function
GO:0050678	0.362	regulation of epithelial cell proliferation
GO:0031399	0.355	regulation of protein modification process
GO:1902533	0.332	positive regulation of intracellular signal transduction
GO:0031063	0.330	regulation of histone deacetylation
GO:0022603	0.327	regulation of anatomical structure morphogenesis
GO:0008284	0.325	positive regulation of cell population proliferation
GO:0045765	0.319	regulation of angiogenesis
GO:0051254	0.317	positive regulation of RNA metabolic process
GO:0006950	0.304	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0016020	0.981	membrane
GO:0071944	0.933	cell periphery
GO:0005886	0.920	plasma membrane
GO:0012505	0.754	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.13	0.958	protein kinase C.

[back to server]