StarFunc result for job id Q9BZQ4

User Input

>input (307 residues)
MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGL
VSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SMTPVIGQPQNETPQPIYQNSNVATKPTAAKILGKVGESLSRICCVRPPVERFTFVDENA
NLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRI
MNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQ
LYINASG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0HA29	0.758	0.758	4.541E-52	307	0.980	0.980	Q0HA29.pdb.gz	NMNA2_RAT Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Nmnat2 PE=2 SV=1
2	AFDB:F7F588	0.709	0.883	8.788E-27	245	0.336	0.420	F7F588.pdb.gz	F7F588_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat3 PE=1 SV=1
3	AFDB:A0JPJ0	0.694	0.745	1.534E-26	285	0.349	0.375	A0JPJ0.pdb.gz	A0JPJ0_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
4	AFDB:Q96T66	0.684	0.830	1.847E-26	252	0.352	0.429	Q96T66.pdb.gz	NMNA3_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Homo sapiens OX=9606 GN=NMNAT3 PE=1 SV=2
5	AFDB:A0A024R4E1	0.717	0.786	3.428E-26	279	0.339	0.373	A0A024R4E1.pdb.gz
6	PDB:1nupA	0.643	0.916	2.791E-23	213	0.319	0.460	1nupA.pdb.gz	STRUCTURAL CHARACTERIZATION OF A HUMAN CYTOSOLIC NMN/NaMN ADENYLYLTRANSFERASE AND IMPLICATION IN HUMAN NAD BIOSYNTHESIS
7	PDB:1kqoA	0.668	0.875	5.865E-23	233	0.313	0.412	1kqoA.pdb.gz	Structure of Hhuman of Nicotinamide/Nicotinic Acid Mononucleotide Adenylyltransferase. Basis for the dual substrate specificity and activation of the oncolytic agent tiazofurin.
8	AFDB:Q9VC03	0.664	0.529	1.752E-22	389	0.319	0.252	Q9VC03.pdb.gz	Q9VC03_DROME Nicotinamide-nucleotide adenylyltransferase OS=Drosophila melanogaster OX=7227 GN=Nmnat PE=1 SV=4
9	PDB:5z9rB	0.672	0.938	2.589E-22	218	0.336	0.472	5z9rB.pdb.gz
10	AFDB:Q9UT53	0.703	0.589	1.106E-20	368	0.274	0.228	Q9UT53.pdb.gz	NMAH_SCHPO Nicotinamide/nicotinic acid mononucleotide adenylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC806.06c PE=1 SV=2
11	AFDB:Q06178	0.697	0.538	4.592E-20	401	0.293	0.224	Q06178.pdb.gz	NMA1_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMA1 PE=1 SV=1
12	AFDB:P53204	0.681	0.534	7.081E-20	395	0.290	0.225	P53204.pdb.gz	NMA2_YEAST Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NMA2 PE=1 SV=1
13	AFDB:F4K688	0.599	0.694	4.758E-18	264	0.241	0.280	F4K688.pdb.gz	F4K688_ARATH Nicotinate/nicotinamide mononucleotide adenyltransferase OS=Arabidopsis thaliana OX=3702 GN=NMNAT PE=1 SV=1
14	PDB:5lltA	0.545	0.786	6.644E-9	205	0.147	0.220	5lltA.pdb.gz	Structural and Functional Characterization of Plasmodium falciparum Nicotinic Acid Mononucleotide Adenylyltransferase.
15	PDB:1k4mA	0.531	0.742	1.485E-8	213	0.150	0.216	1k4mA.pdb.gz	Crystal structures of E. coli nicotinate mononucleotide adenylyltransferase and its complex with deamido-NAD.
16	PDB:3nbkD	0.379	0.649	1.020E-3	163	0.117	0.221	3nbkD.pdb.gz	Kinetic, thermodynamic, and structural insight into the mechanism of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis.
17	PDB:6cckB	0.360	0.620	1.020E-3	160	0.121	0.231	6cckB.pdb.gz	Fragment-Based Drug Discovery of Inhibitors of Phosphopantetheine Adenylyltransferase from Gram-Negative Bacteria.
18	PDB:2qjoB	0.327	0.304	9.467E-3	336	0.114	0.104	2qjoB.pdb.gz	Bifunctional NMN Adenylyltransferase/ADP-Ribose Pyrophosphatase: Structure and Function in Bacterial NAD Metabolism.
19	PDB:3kyjB	0.114	0.253	2.846E-1	129	0.059	0.140	3kyjB.pdb.gz
20	PDB:4tmkA	0.111	0.152	3.220E-1	210	0.042	0.062	4tmkA.pdb.gz	Structural basis for efficient phosphorylation of 3'-azidothymidine monophosphate by Escherichia coli thymidylate kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0HA29	0.0	627	307	0.980	0.980	NMNA2_RAT Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Nmnat2 PE=2 SV=1
2	Q8BNJ3	0.0	630	307	0.987	0.987	NMNA2_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Mus musculus OX=10090 GN=Nmnat2 PE=1 SV=1
3	Q9BZQ4	0.0	640	307	1.000	1.000	NMNA2_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2 OS=Homo sapiens OX=9606 GN=NMNAT2 PE=1 SV=1
4	Q9EPA7	2.85e-57	187	285	0.345	0.372	NMNA1_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Mus musculus OX=10090 GN=Nmnat1 PE=1 SV=2
5	A0JPJ0	5.33e-57	187	285	0.358	0.386	A0JPJ0_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
6	Q9HAN9	8.74e-57	186	279	0.345	0.380	NMNA1_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Homo sapiens OX=9606 GN=NMNAT1 PE=1 SV=1
7	A0A8I5ZV91	1.39e-56	187	316	0.358	0.348	A0A8I5ZV91_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
8	A0A8I5ZK56	1.60e-56	186	306	0.358	0.359	A0A8I5ZK56_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
9	A0A8I6ANE3	2.13e-55	184	306	0.352	0.353	A0A8I6ANE3_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
10	A0A8J8Y7I4	3.91e-53	177	302	0.362	0.368	A0A8J8Y7I4_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat1 PE=1 SV=1
11	F7F588	5.51e-52	173	245	0.352	0.441	F7F588_RAT Nicotinamide-nucleotide adenylyltransferase OS=Rattus norvegicus OX=10116 GN=Nmnat3 PE=1 SV=1
12	Q99JR6	1.30e-46	159	245	0.345	0.433	NMNA3_MOUSE Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Mus musculus OX=10090 GN=Nmnat3 PE=1 SV=1
13	Q96T66	2.64e-41	145	252	0.339	0.413	NMNA3_HUMAN Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3 OS=Homo sapiens OX=9606 GN=NMNAT3 PE=1 SV=2
14	A0A8I5ZM75	1.06e-39	137	127	0.202	0.488	A0A8I5ZM75_RAT Nicotinamide nucleotide adenylyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Nmnat3 PE=1 SV=1
15	D6RHV4	5.66e-39	135	113	0.195	0.531	D6RHV4_HUMAN Nicotinamide nucleotide adenylyltransferase 3 (Fragment) OS=Homo sapiens OX=9606 GN=NMNAT3 PE=1 SV=8
16	A0A2R8Y594	3.41e-38	135	170	0.195	0.353	A0A2R8Y594_HUMAN Nicotinamide nucleotide adenylyltransferase 3 OS=Homo sapiens OX=9606 GN=NMNAT3 PE=1 SV=1
17	A0A2R8YEU0	6.74e-38	135	194	0.195	0.309	A0A2R8YEU0_HUMAN Nicotinamide nucleotide adenylyltransferase 3 OS=Homo sapiens OX=9606 GN=NMNAT3 PE=1 SV=1
18	B1AN62	1.32e-37	133	160	0.179	0.344	B1AN62_HUMAN Nicotinamide nucleotide adenylyltransferase 1 OS=Homo sapiens OX=9606 GN=NMNAT1 PE=1 SV=1
19	D6RGH7	1.27e-36	128	100	0.186	0.570	D6RGH7_HUMAN Nicotinamide nucleotide adenylyltransferase 3 OS=Homo sapiens OX=9606 GN=NMNAT3 PE=1 SV=1
20	Q5XIF7	1.87e-36	129	122	0.186	0.467	Q5XIF7_RAT Nicotinamide nucleotide adenylyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Nmnat3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00107 ADH_zinc_N	5.8e+02	11.9	Zinc-binding dehydrogenase
2	PF01467 CTP_transf_like	1.6e-22	91.7	Cytidylyltransferase-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287713

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401508	0.976	Nicotinate phosphoribosyltransferase
2	9606.ENSP00000222553	0.970	Nicotinamide phosphoribosyltransferase
3	9606.ENSP00000354387	0.963	Nicotinamide riboside kinase 1
4	9606.ENSP00000378782	0.962	Nicotinate-nucleotide pyrophosphorylase [carboxylating]
5	9606.ENSP00000326424	0.961	Glutamine-dependent NAD(+) synthetase
6	9606.ENSP00000480091	0.951	Nicotinamide riboside kinase 2
7	9606.ENSP00000265016	0.942	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2
8	9606.ENSP00000226279	0.933	ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
9	9606.ENSP00000264663	0.929	NAD(P) transhydrogenase, mitochondrial
10	9606.ENSP00000371362	0.916	NAD kinase 2, mitochondrial
11	9606.ENSP00000372191	0.893	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
12	9606.ENSP00000310332	0.869	F-box/SPRY domain-containing protein 1
13	9606.ENSP00000230792	0.860	Peroxisomal NADH pyrophosphatase NUDT12
14	9606.ENSP00000212015	0.853	NAD-dependent protein deacetylase sirtuin-1
15	9606.ENSP00000476228	0.853	NAD-dependent protein deacylase sirtuin-5, mitochondrial
16	9606.ENSP00000340523	0.834	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
17	9606.ENSP00000202967	0.833	NAD-dependent protein lipoamidase sirtuin-4, mitochondrial
18	9606.ENSP00000337332	0.833	NAD-dependent protein deacetylase sirtuin-6
19	9606.ENSP00000329466	0.832	NAD-dependent protein deacetylase sirtuin-7
20	9606.ENSP00000249396	0.830	NAD-dependent protein deacetylase sirtuin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000309	0.998	nicotinamide-nucleotide adenylyltransferase activity
GO:0005515	0.991	protein binding
GO:0140767	0.991	enzyme-substrate adaptor activity
GO:0004515	0.794	nicotinate-nucleotide adenylyltransferase activity
GO:0042802	0.447	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006793	0.995	phosphorus metabolic process
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0009117	0.988	nucleotide metabolic process
GO:1901293	0.985	nucleoside phosphate biosynthetic process
GO:0009165	0.984	nucleotide biosynthetic process
GO:1901564	0.753	organonitrogen compound metabolic process
GO:0006163	0.533	purine nucleotide metabolic process
GO:0050896	0.409	response to stimulus
GO:0072524	0.386	pyridine-containing compound metabolic process
GO:0050789	0.364	regulation of biological process
GO:0046496	0.327	nicotinamide nucleotide metabolic process
GO:0050794	0.306	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.939	endomembrane system
GO:0005829	0.896	cytosol
GO:0016020	0.800	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21360	0.998	ATP + beta-nicotinamide D-ribonucleotide + H(+) = diphosphate + NAD(+)
EC:2.7.7.1	0.998	nicotinamide-nucleotide adenylyltransferase.
RHEA:22860	0.794	ATP + H(+) + nicotinate beta-D-ribonucleotide = deamido-NAD(+) + diphosphate
EC:2.7.7.18	0.794	nicotinate-nucleotide adenylyltransferase.

[back to server]