StarFunc result for job id Q9BZQ6

User Input

>input (932 residues)
MSEAGGRGCGSPVPQRARWRLVAATAAFCLVSATSVWTAGAEPMSREEKQKLGNQVLEMF
DHAYGNYMEHAYPADELMPLTCRGRVRGQEPSRGDVDDALGKFSLTLIDSLDTLVVLNKT
KEFEDAVRKVLRDVNLDNDVVVSVFETNIRVLGGLLGGHSLAIMLKEKGEYMQWYNDELL
QMAKQLGYKLLPAFNTTSGLPYPRINLKFGIRKPEARTGTETDTCTACAGTLILEFAALS
RFTGATIFEEYARKALDFLWEKRQRSSNLVGVTINIHTGDWVRKDSGVGAGIDSYYEYLL
KAYVLLGDDSFLERFNTHYDAIMRYISQPPLLLDVHIHKPMLNARTWMDALLAFFPGLQV
LKGDIRPAIETHEMLYQVIKKHNFLPEAFTTDFRVHWAQHPLRPEFAESTYFLYKATGDP
YYLEVGKTLIENLNKYARVPCGFAAMKDVRTGSHEDRMDSFFLAEMFKYLYLLFADKEDI
IFDIEDYIFTTEAHLLPLWLSTTNQSISKKNTTSEYTELDDSNFDWTCPNTQILFPNDPL
YAQSIREPLKNVVDKSCPRGIIRVEESFRSGAKPPLRARDFMATNPEHLEILKKMGVSLI
HLKDGRVQLVQHAIQAASSIDAEDGLRFMQEMIELSSQQQKEQQLPPRAVQIVSHPFFGR
VVLTAGPAQFGLDLSKHKETRGFVASSKPSNGCSELTNPEAVMGKIALIQRGQCMFAEKA
RNIQNAGAIGGIVIDDNEGSSSDTAPLFQMAGDGKDTDDIKIPMLFLFSKEGSIILDAIR
EYEEVEVLLSDKAKDRDPEMENEEQPSSENDSQNQSGEQISSSSQEVDLVDQESSEENSL
NSHPESLSLADMDNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPN
VSWGKKVQPIDSILADWNEDIEAFEMMEKDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E1BQI6	0.500	0.523	0.000	891	0.803	0.840	E1BQI6.pdb.gz
2	AFDB:Q9BZQ6	1.000	1.000	0.000	932	1.000	1.000	Q9BZQ6.pdb.gz	EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens OX=9606 GN=EDEM3 PE=1 SV=2
3	AFDB:Q8MS36	0.523	0.606	4.672E-85	801	0.405	0.471	Q8MS36.pdb.gz	Q8MS36_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem2 PE=2 SV=1
4	AFDB:Q9FG93	0.461	0.683	1.598E-44	624	0.215	0.321	Q9FG93.pdb.gz	MNS4_ARATH Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
5	AFDB:O94726	0.492	0.580	3.524E-44	787	0.241	0.286	O94726.pdb.gz	MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
6	AFDB:Q9SXC9	0.458	0.737	4.607E-43	574	0.209	0.340	Q9SXC9.pdb.gz	MNS5_ARATH Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
7	AFDB:M9PG98	0.467	0.435	9.797E-40	1004	0.229	0.212	M9PG98.pdb.gz	M9PG98_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem1 PE=1 SV=1
8	AFDB:Q9BV94	0.450	0.720	7.436E-39	578	0.220	0.355	Q9BV94.pdb.gz	EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
9	AFDB:Q57W80	0.457	0.702	8.807E-38	597	0.189	0.295	Q57W80.pdb.gz	Q57W80_TRYB2 alpha-1,2-Mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.320 PE=3 SV=1
10	AFDB:Q8H116	0.424	0.682	1.360E-28	572	0.157	0.255	Q8H116.pdb.gz	MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
11	PDB:1dl2A	0.429	0.763	1.583E-24	510	0.138	0.253	1dl2A.pdb.gz
12	PDB:2rgkA	0.264	0.513	2.672E-6	409	0.056	0.127	2rgkA.pdb.gz
13	PDB:1fp3A	0.295	0.604	3.493E-5	402	0.062	0.144	1fp3A.pdb.gz
14	PDB:1ut9A	0.197	0.279	3.642E-3	605	0.059	0.091	1ut9A.pdb.gz
15	PDB:3qxqA	0.234	0.516	4.663E-3	338	0.036	0.101	3qxqA.pdb.gz	Apo- and cellopentaose-bound structures of the bacterial cellulose synthase subunit BcsZ.
16	PDB:7zqsB	0.111	0.155	7.276E-3	639	0.034	0.050	7zqsB.pdb.gz	Discovery of a Transferrin Receptor 1-Binding Aptamer and Its Application in Cancer Cell Depletion for Adoptive T-Cell Therapy Manufacturing.
17	PDB:5hssA	0.211	0.438	8.867E-3	366	0.045	0.115	5hssA.pdb.gz	X-ray structure of linalool dehydratase/isomerase from Castellaniella defragrans reveals enzymatic alkene synthesis.
18	PDB:6wq1A	0.196	0.387	1.081E-2	396	0.042	0.098	6wq1A.pdb.gz	LanCLs add glutathione to dehydroamino acids generated at phosphorylated sites in the proteome.
19	PDB:3aniA	0.216	0.431	1.253E-2	378	0.056	0.138	3aniA.pdb.gz
20	PDB:3fedA	0.076	0.101	1.686E-2	690	0.021	0.029	3fedA.pdb.gz	Structural insight into the evolutionary and pharmacologic homology of glutamate carboxypeptidases II and III

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M9PCV1	0.0	780	792	0.406	0.477	M9PCV1_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem2 PE=1 SV=1
2	Q2HXL6	0.0	1807	931	0.945	0.946	EDEM3_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Mus musculus OX=10090 GN=Edem3 PE=1 SV=2
3	Q8MS36	0.0	786	801	0.408	0.474	Q8MS36_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem2 PE=2 SV=1
4	Q9BZQ6	0.0	1943	932	1.000	1.000	EDEM3_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 3 OS=Homo sapiens OX=9606 GN=EDEM3 PE=1 SV=2
5	Q9VK27	0.0	788	801	0.409	0.476	Q9VK27_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem2 PE=1 SV=2
6	Q92611	6.82e-124	392	657	0.225	0.320	EDEM1_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Homo sapiens OX=9606 GN=EDEM1 PE=1 SV=1
7	Q925U4	2.03e-123	390	652	0.224	0.321	EDEM1_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Mus musculus OX=10090 GN=Edem1 PE=1 SV=1
8	Q5ZK76	1.87e-119	379	616	0.219	0.331	Q5ZK76_CHICK alpha-1,2-Mannosidase OS=Gallus gallus OX=9031 GN=EDEM1 PE=2 SV=1
9	Q9FG93	5.18e-118	375	624	0.220	0.329	MNS4_ARATH Alpha-mannosidase I MNS4 OS=Arabidopsis thaliana OX=3702 GN=MNS4 PE=1 SV=1
10	Q9SXC9	6.70e-106	342	574	0.216	0.350	MNS5_ARATH Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
11	O94726	4.80e-104	343	787	0.204	0.241	MNL1_SCHPO ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mnl1 PE=3 SV=2
12	Q8BJT9	8.04e-101	328	577	0.214	0.345	EDEM2_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1
13	Q9BV94	1.24e-99	325	578	0.212	0.343	EDEM2_HUMAN ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Homo sapiens OX=9606 GN=EDEM2 PE=1 SV=2
14	O46091	5.79e-95	323	995	0.217	0.203	O46091_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem1 PE=3 SV=1
15	Q7JUF8	8.10e-95	323	982	0.217	0.206	Q7JUF8_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem1 PE=1 SV=1
16	M9PG98	1.33e-94	323	1004	0.217	0.201	M9PG98_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=Edem1 PE=1 SV=1
17	P38888	4.68e-83	286	796	0.192	0.225	MNL1_YEAST ER degradation-enhancing alpha-mannosidase-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNL1 PE=1 SV=1
18	Q57W82	1.55e-79	271	588	0.189	0.299	Q57W82_TRYB2 alpha-1,2-Mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.300 PE=3 SV=1
19	Q57W81	3.95e-70	246	597	0.182	0.285	Q57W81_TRYB2 alpha-1,2-Mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.310 PE=3 SV=1
20	Q57W80	2.34e-68	241	597	0.178	0.278	Q57W80_TRYB2 alpha-1,2-Mannosidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28F14.320 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07944 Glyco_hydro_127	3.5e+02	11.1	Beta-L-arabinofuranosidase, GH127
2	PF01532 Glyco_hydro_47	2.5e-111	384.5	Glycosyl hydrolase family 47
3	PF02225 PA	7.9e-11	53.2	PA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318147

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337053	0.987	Protein sel-1 homolog 1
2	9606.ENSP00000363616	0.942	ER degradation-enhancing alpha-mannosidase-like protein 2
3	9606.ENSP00000318165	0.931	Protein OS-9
4	9606.ENSP00000261483	0.923	Alpha-mannosidase 2
5	9606.ENSP00000247461	0.919	Calnexin
6	9606.ENSP00000185150	0.901	Endoplasmic reticulum lectin 1
7	9606.ENSP00000420608	0.861	ER membrane protein complex subunit 1
8	9606.ENSP00000264065	0.856	DnaJ homolog subfamily C member 10
9	9606.ENSP00000466134	0.854	Glucosidase 2 subunit beta
10	9606.ENSP00000233616	0.850	Mannosyl-oligosaccharide glucosidase
11	9606.ENSP00000295770	0.849	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
12	9606.ENSP00000320866	0.844	Calreticulin
13	9606.ENSP00000340466	0.837	Neutral alpha-glucosidase AB
14	9606.ENSP00000256497	0.829	ER degradation-enhancing alpha-mannosidase-like protein 1
15	9606.ENSP00000300289	0.801	Protein disulfide-isomerase A3
16	9606.ENSP00000299767	0.797	Endoplasmin
17	9606.ENSP00000324173	0.796	78 kDa glucose-regulated protein
18	9606.ENSP00000251047	0.788	Protein ERGIC-53
19	9606.ENSP00000296255	0.781	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1
20	9606.ENSP00000376472	0.764	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004571	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0005488	0.726	binding
GO:0005515	0.549	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0030433	0.988	ubiquitin-dependent ERAD pathway
GO:0036211	0.965	protein modification process
GO:0006517	0.949	protein deglycosylation
GO:1901136	0.920	carbohydrate derivative catabolic process
GO:0006516	0.910	glycoprotein catabolic process
GO:1901700	0.665	response to oxygen-containing compound
GO:0065007	0.435	biological regulation
GO:0050794	0.369	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0070013	0.988	intracellular organelle lumen
GO:0005788	0.729	endoplasmic reticulum lumen
GO:0044322	0.447	endoplasmic reticulum quality control compartment
GO:0032991	0.378	protein-containing complex
GO:0016020	0.367	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.113	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase.

[back to server]