StarFunc result for job id Q9BZQ8

User Input

>input (928 residues)
MGGSASSQLDEGKCAYIRGKTEAAIKNFSPYYSRQYSVAFCNHVRTEVEQQRDLTSQFLK
TKPPLAPGTILYEAELSQFSEDIKKWKERYVVVKNDYAVESYENKEAYQRGAAPKCRILP
AGGKVLTSEDEYNLLSDRHFPDPLASSEKENTQPFVVLPKEFPVYLWQPFFRHGYFCFHE
AADQKRFSALLSDCVRHLNHDYMKQMTFEAQAFLEAVQFFRQEKGHYGSWEMITGDEIQI
LSNLVMEELLPTLQTDLLPKMKGKKNDRKRTWLGLLEEAYTLVQHQVSEGLSALKEECRA
LTKGLEGTIRSDMDQIVNSKNYLIGKIKAMVAQPAEKSCLESVQPFLASILEELMGPVSS
GFSEVRVLFEKEVNEVSQNFQTTKDSVQLKEHLDRLMNLPLHSVKMEPCYTKVNLLHERL
QDLKSRFRFPHIDLVVQRTQNYMQELMENAVFTFEQLLSPHLQGEASKTAVAIEKVKLRV
LKQYDYDSSTIRKKIFQEALVQITLPTVQKALASTCKPELQKYEQFIFADHTNMIHVENV
YEEILHQILLDETLKVIKEAAILKKHNLFEDNMALPSESVSSLTDLKPPTGSNQASPARR
ASAILPGVLGSETLSNEVFQESEEEKQPEVPSSLAKGESLSLPGPSPPPDGTEQVIISRV
DDPVVNPVATEDTAGLPGTCSSELEFGGTLEDEEPAQEEPEPITASGSLKALRKLLTASV
EVPVDSAPVMEEDTNGESHVPQENEEEEEKEPSQAAAIHPDNCEESEVSEREAQPPCPEA
HGEELGGFPEVGSPASPPASGGLTEEPLGPMEGELPGEACTLTAHEGRGGKCTEEGDASQ
QEGCTLGSDPICLSESQVSEEQEEMGGQSSAAQATASVNAEEIKVARIHECQWVVEDAPN
PDVLLSHKDDVKEGEGGQESFPELPSEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BZQ8	1.000	1.000	0.000	928	1.000	1.000	Q9BZQ8.pdb.gz	NIBA1_HUMAN Protein Niban 1 OS=Homo sapiens OX=9606 GN=NIBAN1 PE=1 SV=1
2	AFDB:Q3UW53	0.652	0.653	2.508E-87	926	0.731	0.732	Q3UW53.pdb.gz	NIBA1_MOUSE Protein Niban 1 OS=Mus musculus OX=10090 GN=Niban1 PE=1 SV=2
3	AFDB:A0A024R872	0.579	0.727	1.261E-43	733	0.270	0.342	A0A024R872.pdb.gz
4	AFDB:P26675	0.090	0.054	2.221E-5	1596	0.143	0.083	P26675.pdb.gz	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
5	AFDB:H8ESG1	0.058	0.043	3.383E-4	1494	0.123	0.076	H8ESG1.pdb.gz	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
6	PDB:3ljuX	0.099	0.238	1.413E-3	373	0.019	0.048	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
7	AFDB:G5ECK4	0.073	0.052	3.625E-3	1523	0.127	0.077	G5ECK4.pdb.gz	G5ECK4_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnbp-1 PE=1 SV=1
8	AFDB:E9PD50	0.070	0.060	3.958E-3	1170	0.145	0.115	E9PD50.pdb.gz	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1
9	AFDB:X1WE68	0.092	0.047	7.993E-3	2527	0.142	0.052	X1WE68.pdb.gz
10	AFDB:Q96QP1	0.062	0.057	1.354E-2	1244	0.119	0.088	Q96QP1.pdb.gz	ALPK1_HUMAN Alpha-protein kinase 1 OS=Homo sapiens OX=9606 GN=ALPK1 PE=1 SV=3
11	AFDB:Q961B0	0.069	0.064	1.415E-2	1067	0.112	0.097	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
12	PDB:6s9wA	0.089	0.190	7.689E-2	411	0.023	0.051	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
13	PDB:6hhgA	0.093	0.213	8.034E-2	386	0.022	0.052	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
14	PDB:6bbpA	0.092	0.159	1.193E-1	520	0.014	0.025	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
15	PDB:7np7D1	0.071	0.111	1.553E-1	485	0.069	0.132	7np7D1.pdb.gz
16	PDB:5kcvA	0.082	0.201	2.748E-1	353	0.020	0.054	5kcvA.pdb.gz	Discovery of 3-(3-(4-(1-Aminocyclobutyl)phenyl)-5-phenyl-3H-imidazo[4,5-b]pyridin-2-yl)pyridin-2-amine (ARQ 092): An Orally Bioavailable, Selective, and Potent Allosteric AKT Inhibitor.
17	PDB:4gouA	0.080	0.116	3.001E-1	507	0.059	0.108	4gouA.pdb.gz
18	PDB:3szrA	0.073	0.114	3.135E-1	559	0.046	0.077	3szrA.pdb.gz
19	PDB:2j68A	0.156	0.196	4.081E-1	680	0.058	0.079	2j68A.pdb.gz	A Bacterial Dynamin-Like Protein
20	PDB:4mk0A	0.101	0.147	5.799E-1	631	0.016	0.024	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UW53	0.0	1298	926	0.732	0.733	NIBA1_MOUSE Protein Niban 1 OS=Mus musculus OX=10090 GN=Niban1 PE=1 SV=2
2	Q9BZQ8	0.0	1907	928	1.000	1.000	NIBA1_HUMAN Protein Niban 1 OS=Homo sapiens OX=9606 GN=NIBAN1 PE=1 SV=1
3	Q8R1F1	3.59e-146	453	749	0.255	0.316	NIBA2_MOUSE Protein Niban 2 OS=Mus musculus OX=10090 GN=Niban2 PE=1 SV=2
4	Q96TA1	2.14e-143	446	746	0.250	0.311	NIBA2_HUMAN Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3
5	Q86XR2	1.28e-68	244	697	0.170	0.227	NIBA3_HUMAN Protein Niban 3 OS=Homo sapiens OX=9606 GN=NIBAN3 PE=1 SV=2
6	Q8IIZ6	3.8	33.9	2194	0.031	0.013	Q8IIZ6_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1041300 PE=4 SV=2
7	Q8IEL5	8.1	32.0	253	0.025	0.091	Q8IEL5_PLAF7 ATP synthase subunit O, mitochondrial, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1310000 PE=3 SV=1
8	X2J9G3	9.4	30.0	85	0.027	0.294	X2J9G3_DROME Uncharacterized protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Dmel\CG11034 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356481

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296930	0.867	Nucleophosmin
2	9606.ENSP00000287859	0.724	Protein odr-4 homolog
3	9606.ENSP00000356375	0.724	Zinc finger and BTB domain-containing protein 41
4	9606.ENSP00000347586	0.710	Coiled-coil domain-containing protein 69
5	9606.ENSP00000369979	0.694	Probable carboxypeptidase X1
6	9606.ENSP00000376472	0.610	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
7	9606.ENSP00000306015	0.553	Synaptopodin-2
8	9606.ENSP00000457511	0.543	Coiled-coil domain containing 179

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0009987	0.983	cellular process
GO:0051246	0.972	regulation of protein metabolic process
GO:0050794	0.968	regulation of cellular process
GO:0031323	0.949	regulation of cellular metabolic process
GO:0051716	0.946	cellular response to stimulus
GO:0048519	0.928	negative regulation of biological process
GO:0010468	0.928	regulation of gene expression
GO:0009889	0.922	regulation of biosynthetic process
GO:0048522	0.922	positive regulation of cellular process
GO:0051174	0.922	regulation of phosphorus metabolic process
GO:0010556	0.902	regulation of macromolecule biosynthetic process
GO:0031326	0.902	regulation of cellular biosynthetic process
GO:0010605	0.856	negative regulation of macromolecule metabolic process
GO:0031399	0.851	regulation of protein modification process
GO:0009893	0.805	positive regulation of metabolic process
GO:0051172	0.797	negative regulation of nitrogen compound metabolic process
GO:0010604	0.764	positive regulation of macromolecule metabolic process
GO:0051173	0.733	positive regulation of nitrogen compound metabolic process
GO:0033554	0.722	cellular response to stress
GO:0031324	0.704	negative regulation of cellular metabolic process
GO:0031325	0.689	positive regulation of cellular metabolic process
GO:2000112	0.673	regulation of cellular macromolecule biosynthetic process
GO:0034248	0.579	regulation of amide metabolic process
GO:0019220	0.555	regulation of phosphate metabolic process
GO:0010557	0.532	positive regulation of macromolecule biosynthetic process
GO:0031328	0.530	positive regulation of cellular biosynthetic process
GO:0051248	0.520	negative regulation of protein metabolic process
GO:0010608	0.474	post-transcriptional regulation of gene expression
GO:0031400	0.463	negative regulation of protein modification process
GO:0001932	0.456	regulation of protein phosphorylation
GO:0051247	0.449	positive regulation of protein metabolic process
GO:0010628	0.447	positive regulation of gene expression
GO:0001933	0.385	negative regulation of protein phosphorylation
GO:0045727	0.328	positive regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.999	plasma membrane
GO:0005615	0.996	extracellular space
GO:0031982	0.996	vesicle
GO:0070062	0.990	extracellular exosome
GO:0043231	0.932	intracellular membrane-bounded organelle
GO:0005634	0.736	nucleus
GO:0031974	0.719	membrane-enclosed lumen
GO:0070013	0.712	intracellular organelle lumen
GO:0005654	0.446	nucleoplasm
GO:0012505	0.311	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]