StarFunc result for job id Q9BZR6

User Input

>input (473 residues)
MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQ
RIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRS
VDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNL
THLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSA
LPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKR
LAANDLQGCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPGRPASAGNALK
GRVPPGDSPPGNGSGPRHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCS
RKNRTRSHCRLGQAGSGGGGTGDSEGSGALPSLTCSLTPLGLALVLWTVLGPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BZR6	0.999	0.999	2.874E-79	473	1.000	1.000	Q9BZR6.pdb.gz	RTN4R_HUMAN Reticulon-4 receptor OS=Homo sapiens OX=9606 GN=RTN4R PE=1 SV=1
2	AFDB:Q99M75	0.718	0.718	3.705E-71	473	0.896	0.896	Q99M75.pdb.gz	RTN4R_RAT Reticulon-4 receptor OS=Rattus norvegicus OX=10116 GN=Rtn4r PE=1 SV=2
3	AFDB:F1QPB1	0.667	0.658	2.061E-41	479	0.444	0.438	F1QPB1.pdb.gz
4	AFDB:Q7M6Z0	0.620	0.696	3.652E-34	420	0.381	0.429	Q7M6Z0.pdb.gz	R4RL2_MOUSE Reticulon-4 receptor-like 2 OS=Mus musculus OX=10090 GN=Rtn4rl2 PE=1 SV=1
5	AFDB:Q8R5M3	0.262	0.226	6.468E-19	578	0.247	0.202	Q8R5M3.pdb.gz	LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus OX=10116 GN=Lrrc15 PE=2 SV=1
6	AFDB:Q9GZU5	0.440	0.433	8.342E-19	481	0.260	0.256	Q9GZU5.pdb.gz	NYX_HUMAN Nyctalopin OS=Homo sapiens OX=9606 GN=NYX PE=1 SV=1
7	AFDB:D4A6D8	0.501	0.458	1.076E-18	523	0.203	0.184	D4A6D8.pdb.gz	LRRT1_RAT Leucine-rich repeat transmembrane neuronal protein 1 OS=Rattus norvegicus OX=10116 GN=Lrrtm1 PE=3 SV=1
8	AFDB:P83503	0.439	0.437	1.883E-18	476	0.247	0.246	P83503.pdb.gz	NYX_MOUSE Nyctalopin OS=Mus musculus OX=10090 GN=Nyx PE=2 SV=1
9	AFDB:Q9VU51	0.260	0.196	3.296E-18	737	0.266	0.171	Q9VU51.pdb.gz	Q9VU51_DROME GH10871p OS=Drosophila melanogaster OX=7227 GN=trn PE=2 SV=1
10	AFDB:O43155	0.432	0.327	1.302E-17	660	0.209	0.150	O43155.pdb.gz	FLRT2_HUMAN Leucine-rich repeat transmembrane protein FLRT2 OS=Homo sapiens OX=9606 GN=FLRT2 PE=1 SV=1
11	PDB:1xcdA	0.428	0.627	3.302E-11	305	0.146	0.226	1xcdA.pdb.gz
12	PDB:7wv3A	0.435	0.317	6.994E-10	668	0.129	0.091	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:7wrqA	0.436	0.370	2.372E-9	566	0.184	0.154	7wrqA.pdb.gz
14	PDB:2ft3F	0.408	0.600	2.626E-9	305	0.144	0.223	2ft3F.pdb.gz
15	PDB:5y31B	0.231	0.216	1.640E-8	511	0.104	0.096	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
16	PDB:5yq5B	0.335	0.470	2.870E-8	306	0.133	0.206	5yq5B.pdb.gz
17	PDB:7tvfD	0.387	0.358	2.870E-8	515	0.129	0.118	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
18	PDB:6gffI	0.328	0.290	3.020E-8	551	0.144	0.123	6gffI.pdb.gz
19	PDB:3b2dA	0.214	0.186	3.178E-8	601	0.129	0.101	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
20	PDB:3t6qA	0.282	0.235	3.702E-8	601	0.118	0.093	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99M75	0.0	858	473	0.896	0.896	RTN4R_RAT Reticulon-4 receptor OS=Rattus norvegicus OX=10116 GN=Rtn4r PE=1 SV=2
2	Q99PI8	0.0	857	473	0.894	0.894	RTN4R_MOUSE Reticulon-4 receptor OS=Mus musculus OX=10090 GN=Rtn4r PE=1 SV=1
3	Q9BZR6	0.0	946	473	1.000	1.000	RTN4R_HUMAN Reticulon-4 receptor OS=Homo sapiens OX=9606 GN=RTN4R PE=1 SV=1
4	Q6X3Y5	1.98e-132	393	479	0.425	0.420	Q6X3Y5_DANRE Reticulon-4 receptor precursor OS=Danio rerio OX=7955 GN=ngr PE=2 SV=1
5	Q8K0S5	7.16e-99	306	445	0.385	0.409	R4RL1_MOUSE Reticulon-4 receptor-like 1 OS=Mus musculus OX=10090 GN=Rtn4rl1 PE=1 SV=1
6	Q86UN2	2.05e-98	305	441	0.385	0.413	R4RL1_HUMAN Reticulon-4 receptor-like 1 OS=Homo sapiens OX=9606 GN=RTN4RL1 PE=1 SV=1
7	Q80WD0	7.33e-98	303	445	0.387	0.411	R4RL1_RAT Reticulon-4 receptor-like 1 OS=Rattus norvegicus OX=10116 GN=Rtn4rl1 PE=1 SV=1
8	Q6WZD2	2.26e-97	303	478	0.332	0.328	Q6WZD2_DANRE Nogo receptor homolog 2a OS=Danio rerio OX=7955 GN=ngrh2a PE=2 SV=1
9	Q6WZD1	3.50e-96	299	457	0.336	0.348	Q6WZD1_DANRE Nogo receptor homolog 1b OS=Danio rerio OX=7955 GN=ngrh1b PE=2 SV=1
10	Q86UN3	1.07e-94	294	420	0.326	0.367	R4RL2_HUMAN Reticulon-4 receptor-like 2 OS=Homo sapiens OX=9606 GN=RTN4RL2 PE=1 SV=1
11	Q7M6Z0	1.57e-94	294	420	0.328	0.369	R4RL2_MOUSE Reticulon-4 receptor-like 2 OS=Mus musculus OX=10090 GN=Rtn4rl2 PE=1 SV=1
12	Q80WD1	2.08e-94	293	420	0.328	0.369	R4RL2_RAT Reticulon-4 receptor-like 2 OS=Rattus norvegicus OX=10116 GN=Rtn4rl2 PE=1 SV=1
13	Q6WZD3	8.50e-84	267	458	0.292	0.301	Q6WZD3_DANRE Nogo receptor homolog 1a OS=Danio rerio OX=7955 GN=ngrh1a PE=2 SV=1
14	Q00P20	8.65e-33	132	469	0.199	0.200	Q00P20_DANRE Nyctalopin OS=Danio rerio OX=7955 GN=nyx PE=2 SV=1
15	Q45R42	3.28e-32	132	652	0.211	0.153	LRRC4_RAT Leucine-rich repeat-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrrc4 PE=1 SV=1
16	P0CC10	4.29e-32	132	709	0.216	0.144	LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1
17	P0C192	4.80e-32	132	709	0.216	0.144	LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1
18	Q9HBW1	6.43e-32	131	653	0.211	0.153	LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=LRRC4 PE=1 SV=2
19	Q99PH1	8.18e-32	130	652	0.211	0.153	LRRC4_MOUSE Leucine-rich repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Lrrc4 PE=1 SV=2
20	Q9NT99	1.13e-31	130	713	0.216	0.143	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	0.15	23.5	Leucine Rich Repeat
2	PF12799 LRR_4	6.5e-16	69.4	Leucine Rich repeats (2 copies)
3	PF13306 LRR_5	2.3e-06	39.0	BspA type Leucine rich repeat region (6 copies)
4	PF13855 LRR_8	1.1e-41	151.7	Leucine rich repeat
5	PF14580 LRR_9	4.4e-07	41.1	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000043402

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000172229	0.999	Tumor necrosis factor receptor superfamily member 16
2	9606.ENSP00000337838	0.999	Reticulon-4
3	9606.ENSP00000376048	0.997	Myelin-associated glycoprotein
4	9606.ENSP00000300060	0.989	Aminopeptidase N
5	9606.ENSP00000371693	0.985	Tumor necrosis factor receptor superfamily member 19
6	9606.ENSP00000398698	0.973	Tumor necrosis factor
7	9606.ENSP00000347451	0.971	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
8	9606.ENSP00000284981	0.968	Amyloid-beta A4 protein
9	9606.ENSP00000400175	0.966	Transforming protein RhoA
10	9606.ENSP00000247271	0.959	Oligodendrocyte-myelin glycoprotein
11	9606.ENSP00000269321	0.930	Rho GDP-dissociation inhibitor 1
12	9606.ENSP00000371219	0.855	Rho-related GTP-binding protein RhoH
13	9606.ENSP00000318406	0.848	Dyslexia-associated protein KIAA0319-like protein
14	9606.ENSP00000245620	0.782	Leukocyte immunoglobulin-like receptor subfamily B member 3
15	9606.ENSP00000470560	0.737	Ribosomal RNA small subunit methyltransferase NEP1
16	9606.ENSP00000365048	0.670	Tumor necrosis factor ligand superfamily member 13B
17	9606.ENSP00000349932	0.667	Receptor-type tyrosine-protein phosphatase S
18	9606.ENSP00000380998	0.666	Charged multivesicular body protein 1a
19	9606.ENSP00000267484	0.657	Reticulon-1
20	9606.ENSP00000256637	0.655	Sortilin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.999	signaling receptor activity
GO:0097367	0.889	carbohydrate derivative binding
GO:0043167	0.399	ion binding
GO:0046625	0.367	sphingolipid binding
GO:0051861	0.367	glycolipid binding
GO:0097001	0.333	ceramide binding
GO:0043208	0.333	glycosphingolipid binding
GO:0031406	0.333	carboxylic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0050896	0.988	response to stimulus
GO:0051128	0.983	regulation of cellular component organization
GO:0048519	0.967	negative regulation of biological process
GO:0048518	0.926	positive regulation of biological process
GO:0031344	0.919	regulation of cell projection organization
GO:0048523	0.910	negative regulation of cellular process
GO:0050793	0.898	regulation of developmental process
GO:0120035	0.896	regulation of plasma membrane bounded cell projection organization
GO:0048522	0.882	positive regulation of cellular process
GO:0007165	0.880	signal transduction
GO:0051239	0.873	regulation of multicellular organismal process
GO:0051129	0.865	negative regulation of cellular component organization
GO:0032502	0.855	developmental process
GO:2000026	0.820	regulation of multicellular organismal development
GO:0048856	0.812	anatomical structure development
GO:0048583	0.789	regulation of response to stimulus
GO:0032501	0.778	multicellular organismal process
GO:0009966	0.769	regulation of signal transduction
GO:1902531	0.747	regulation of intracellular signal transduction
GO:0022603	0.732	regulation of anatomical structure morphogenesis
GO:0010975	0.717	regulation of neuron projection development
GO:0051241	0.716	negative regulation of multicellular organismal process
GO:0060284	0.709	regulation of cell development
GO:0048584	0.663	positive regulation of response to stimulus
GO:0007275	0.653	multicellular organism development
GO:0048731	0.617	system development
GO:0071840	0.591	cellular component organization or biogenesis
GO:0051093	0.564	negative regulation of developmental process
GO:1902533	0.560	positive regulation of intracellular signal transduction
GO:0031345	0.550	negative regulation of cell projection organization
GO:0010721	0.525	negative regulation of cell development
GO:0016043	0.519	cellular component organization
GO:0050770	0.504	regulation of axonogenesis
GO:0051960	0.471	regulation of nervous system development
GO:0050767	0.459	regulation of neurogenesis
GO:0010977	0.451	negative regulation of neuron projection development
GO:0051056	0.441	regulation of small GTPase mediated signal transduction
GO:0050768	0.435	negative regulation of neurogenesis
GO:0050771	0.415	negative regulation of axonogenesis
GO:0035023	0.356	regulation of Rho protein signal transduction
GO:0007399	0.328	nervous system development
GO:0007166	0.304	cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0071944	0.997	cell periphery
GO:0009986	0.978	cell surface
GO:0005886	0.959	plasma membrane
GO:0043226	0.905	organelle
GO:0043227	0.855	membrane-bounded organelle
GO:0005576	0.706	extracellular region
GO:0043231	0.688	intracellular membrane-bounded organelle
GO:0005737	0.675	cytoplasm
GO:0031982	0.584	vesicle
GO:0012505	0.495	endomembrane system
GO:0005615	0.413	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]