StarFunc result for job id Q9BZS1

User Input

>input (431 residues)
MPNPRPGKPSAPSLALGPSPGASPSWRAAPKASDLLGARGPGGTFQGRDLRGGAHASSSS
LNPMPPSQLQLPTLPLVMVAPSGARLGPLPHLQALLQDRPHFMHQLSTVDAHARTPVLQV
HPLESPAMISLTPPTTATGVFSLKARPGLPPGINVASLEWVSREPALLCTFPNPSAPRKD
STLSAVPQSSYPLLANGVCKWPGCEKVFEEPEDFLKHCQADHLLDEKGRAQCLLQREMVQ
SLEQQLVLEKEKLSAMQAHLAGKMALTKASSVASSDKGSCCIVAAGSQGPVVPAWSGPRE
APDSLFAVRRHLWGSHGNSTFPEFLHNMDYFKFHNMRPPFTYATLIRWAILEAPEKQRTL
NEIYHWFTRMFAFFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDELEFRKKRSQR
PSRCSNPTPGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6U8D7	0.659	0.659	9.022E-66	431	0.986	0.986	Q6U8D7.pdb.gz	FOXP3_MACFA Forkhead box protein P3 OS=Macaca fascicularis OX=9541 GN=FOXP3 PE=2 SV=1
2	AFDB:B7ZLG1	0.517	0.493	2.571E-64	454	1.000	0.949	B7ZLG1.pdb.gz	B7ZLG1_HUMAN FOXP3 protein OS=Homo sapiens OX=9606 GN=FOXP3 PE=1 SV=1
3	AFDB:D3ZKI1	0.537	0.540	1.857E-59	429	0.861	0.865	D3ZKI1.pdb.gz	D3ZKI1_RAT Forkhead box P3 OS=Rattus norvegicus OX=10116 GN=Foxp3 PE=4 SV=2
4	AFDB:E3VW73	0.224	0.218	4.607E-25	443	0.332	0.323	E3VW73.pdb.gz	E3VW73_SALSA Forkhead box P3 OS=Salmo salar OX=8030 GN=foxp3 PE=2 SV=1
5	PDB:2hdcA	0.167	0.596	8.340E-6	97	0.077	0.340	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
6	AFDB:P98177	0.179	0.154	4.474E-3	505	0.116	0.099	P98177.pdb.gz	FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4 PE=1 SV=5
7	AFDB:P46665	0.072	0.088	4.766E-3	336	0.128	0.164	P46665.pdb.gz	HAT14_ARATH Homeobox-leucine zipper protein HAT14 OS=Arabidopsis thaliana OX=3702 GN=HAT14 PE=2 SV=3
8	AFDB:F4IIX4	0.089	0.066	6.137E-3	652	0.130	0.086	F4IIX4.pdb.gz	F4IIX4_ARATH RING/U-box superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EDA18 PE=4 SV=1
9	AFDB:Q8GYU3	0.081	0.037	8.418E-3	1465	0.165	0.048	Q8GYU3.pdb.gz	IYO_ARATH Transcriptional elongation regulator MINIYO OS=Arabidopsis thaliana OX=3702 GN=IYO PE=1 SV=1
10	AFDB:Q9VSC2	0.103	0.087	1.084E-2	525	0.190	0.156	Q9VSC2.pdb.gz	Q9VSC2_DROME Extra-extra OS=Drosophila melanogaster OX=7227 GN=exex PE=2 SV=1
11	AFDB:Q9U2Z0	0.084	0.090	1.155E-2	391	0.125	0.138	Q9U2Z0.pdb.gz	OTXH_CAEEL Homeobox protein ttx-1 OS=Caenorhabditis elegans OX=6239 GN=ttx-1 PE=1 SV=2
12	PDB:3euhB	0.155	0.200	3.504E-2	321	0.042	0.056	3euhB.pdb.gz
13	PDB:1xsdA	0.143	0.405	5.454E-2	125	0.030	0.104	1xsdA.pdb.gz	Crystal structures of the BlaI repressor from Staphylococcus aureus and its complex with DNA: insights into transcriptional regulation of the bla and mec operons
14	PDB:1r1uC	0.131	0.489	6.189E-2	98	0.030	0.133	1r1uC.pdb.gz
15	PDB:7qenC	0.121	0.168	7.969E-2	291	0.028	0.041	7qenC.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
16	PDB:5hs7A	0.127	0.459	1.026E-1	102	0.030	0.127	5hs7A.pdb.gz
17	PDB:7k5yU	0.145	0.640	1.093E-1	75	0.023	0.133	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
18	PDB:3m8eA	0.113	0.369	1.321E-1	101	0.019	0.079	3m8eA.pdb.gz
19	PDB:7jgrB	0.134	0.187	1.701E-1	290	0.037	0.055	7jgrB.pdb.gz	Structural mechanism for replication origin binding and remodeling by a metazoan origin recognition complex and its co-loader Cdc6.
20	PDB:1fp1D	0.122	0.148	2.057E-1	340	0.026	0.032	1fp1D.pdb.gz	Structures of two natural product methyltransferases reveal the basis for substrate specificity in plant O-methyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G4G9	0.0	712	402	0.807	0.866	A0A8I6G4G9_RAT Forkhead box P3 OS=Rattus norvegicus OX=10116 GN=Foxp3 PE=4 SV=1
2	B7ZLG1	0.0	866	454	1.000	0.949	B7ZLG1_HUMAN FOXP3 protein OS=Homo sapiens OX=9606 GN=FOXP3 PE=1 SV=1
3	D3ZKI1	0.0	685	394	0.784	0.858	D3ZKI1_RAT Forkhead box P3 OS=Rattus norvegicus OX=10116 GN=Foxp3 PE=4 SV=2
4	D4Q8I1	0.0	768	429	0.861	0.865	D4Q8I1_RAT Forkhead box P3 (Predicted), isoform CRA_a OS=Rattus norvegicus OX=10116 GN=Foxp3 PE=2 SV=1
5	D4Q8I2	0.0	767	488	0.861	0.760	D4Q8I2_RAT Forkhead box P3 OS=Rattus norvegicus OX=10116 GN=Foxp3 PE=2 SV=1
6	D4Q8I3	0.0	543	335	0.629	0.809	D4Q8I3_RAT Forkhead box P3 OS=Rattus norvegicus OX=10116 GN=Foxp3 PE=2 SV=1
7	Q6U8D7	0.0	868	431	0.986	0.986	FOXP3_MACFA Forkhead box protein P3 OS=Macaca fascicularis OX=9541 GN=FOXP3 PE=2 SV=1
8	Q99JB6	0.0	766	429	0.863	0.867	FOXP3_MOUSE Forkhead box protein P3 OS=Mus musculus OX=10090 GN=Foxp3 PE=1 SV=1
9	Q9BZS1	0.0	879	431	1.000	1.000	FOXP3_HUMAN Forkhead box protein P3 OS=Homo sapiens OX=9606 GN=FOXP3 PE=1 SV=1
10	Q5W1J5	5.36e-68	228	578	0.281	0.209	FOXP1_XENLA Forkhead box protein P1 OS=Xenopus laevis OX=8355 GN=foxp1 PE=1 SV=1
11	Q9H334	5.97e-68	230	677	0.278	0.177	FOXP1_HUMAN Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1 PE=1 SV=1
12	Q4JNX5	9.07e-68	230	697	0.283	0.175	Q4JNX5_DANRE Forkhead box P2 OS=Danio rerio OX=7955 GN=foxp2 PE=2 SV=1
13	Q58NQ4	1.32e-67	229	686	0.288	0.181	FOXP1_CHICK Forkhead box protein P1 OS=Gallus gallus OX=9031 GN=FOXP1 PE=2 SV=1
14	Q6QBA5	2.18e-66	226	711	0.276	0.167	Q6QBA5_TAEGU Forkhead box P2 isoform I OS=Taeniopygia guttata OX=59729 GN=FoxP2 PE=2 SV=1
15	Q6TKS2	2.34e-66	226	709	0.276	0.168	Q6TKS2_TAEGU Forkhead box P2 OS=Taeniopygia guttata OX=59729 GN=FoxP2 PE=2 SV=1
16	Q498D1	2.66e-66	226	711	0.276	0.167	FOXP1_RAT Forkhead box protein P1 OS=Rattus norvegicus OX=10116 GN=Foxp1 PE=1 SV=1
17	P58462	2.81e-66	226	705	0.276	0.169	FOXP1_MOUSE Forkhead box protein P1 OS=Mus musculus OX=10090 GN=Foxp1 PE=1 SV=1
18	O15409	3.17e-66	226	715	0.274	0.165	FOXP2_HUMAN Forkhead box protein P2 OS=Homo sapiens OX=9606 GN=FOXP2 PE=1 SV=2
19	P0CF24	3.28e-66	226	710	0.274	0.166	FOXP2_RAT Forkhead box protein P2 OS=Rattus norvegicus OX=10116 GN=Foxp2 PE=3 SV=1
20	P58463	3.29e-66	226	714	0.274	0.165	FOXP2_MOUSE Forkhead box protein P2 OS=Mus musculus OX=10090 GN=Foxp2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1.1e-22	91.3	Forkhead domain
2	PF16159 FOXP-CC	6.3e-25	98.8	FOXP coiled-coil domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365380

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379330	0.999	Nuclear factor of activated T-cells, cytoplasmic 2
2	9606.ENSP00000226730	0.998	Interleukin-2
3	9606.ENSP00000264657	0.996	Signal transducer and activator of transcription 3
4	9606.ENSP00000369293	0.995	Interleukin-2 receptor subunit alpha
5	9606.ENSP00000340330	0.994	Histone acetyltransferase KAT5
6	9606.ENSP00000303939	0.992	Cytotoxic T-lymphocyte protein 4
7	9606.ENSP00000229135	0.989	Interferon gamma
8	9606.ENSP00000370343	0.989	Interferon regulatory factor 4
9	9606.ENSP00000328207	0.987	Tumor necrosis factor receptor superfamily member 18
10	9606.ENSP00000360266	0.987	Transcription factor AP-1
11	9606.ENSP00000300305	0.984	Runt-related transcription factor 1
12	9606.ENSP00000332973	0.978	Mothers against decapentaplegic homolog 3
13	9606.ENSP00000408617	0.974	Histone deacetylase 9
14	9606.ENSP00000327025	0.971	Nuclear receptor ROR-gamma
15	9606.ENSP00000368632	0.970	Trans-acting T-cell-specific transcription factor GATA-3
16	9606.ENSP00000389377	0.970	Nuclear factor of activated T-cells, cytoplasmic 1
17	9606.ENSP00000437955	0.965	Hypoxia-inducible factor 1-alpha
18	9606.ENSP00000287820	0.960	Peroxisome proliferator-activated receptor gamma
19	9606.ENSP00000320147	0.958	Histone-lysine N-methyltransferase EZH2
20	9606.ENSP00000263253	0.939	Histone acetyltransferase p300

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.999	protein binding
GO:0003824	0.975	catalytic activity
GO:0140096	0.929	catalytic activity, acting on a protein
GO:0016740	0.922	transferase activity
GO:0004672	0.906	protein kinase activity
GO:0004674	0.898	protein serine/threonine kinase activity
GO:0042802	0.691	identical protein binding
GO:0000976	0.614	transcription cis-regulatory region binding
GO:0000981	0.378	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.317	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0032502	0.987	developmental process
GO:0009987	0.985	cellular process
GO:0050789	0.984	regulation of biological process
GO:0032501	0.981	multicellular organismal process
GO:0044419	0.972	biological process involved in interspecies interaction between organisms
GO:0009605	0.972	response to external stimulus
GO:0048518	0.971	positive regulation of biological process
GO:0048522	0.964	positive regulation of cellular process
GO:0048856	0.963	anatomical structure development
GO:0009607	0.963	response to biotic stimulus
GO:0048519	0.961	negative regulation of biological process
GO:0019222	0.956	regulation of metabolic process
GO:0060255	0.945	regulation of macromolecule metabolic process
GO:0010468	0.941	regulation of gene expression
GO:0042221	0.939	response to chemical
GO:0002694	0.939	regulation of leukocyte activation
GO:0048583	0.938	regulation of response to stimulus
GO:0050863	0.933	regulation of T cell activation
GO:0001817	0.930	regulation of cytokine production
GO:1902105	0.927	regulation of leukocyte differentiation
GO:0048523	0.920	negative regulation of cellular process
GO:1903037	0.917	regulation of leukocyte cell-cell adhesion
GO:0002696	0.917	positive regulation of leukocyte activation
GO:0045785	0.915	positive regulation of cell adhesion
GO:0051251	0.910	positive regulation of lymphocyte activation
GO:0022409	0.906	positive regulation of cell-cell adhesion
GO:0050870	0.896	positive regulation of T cell activation
GO:0045619	0.891	regulation of lymphocyte differentiation
GO:0032101	0.886	regulation of response to external stimulus
GO:0080134	0.883	regulation of response to stress
GO:0070663	0.883	regulation of leukocyte proliferation
GO:0051707	0.873	response to other organism
GO:0031347	0.872	regulation of defense response
GO:0002683	0.865	negative regulation of immune system process
GO:1902107	0.860	positive regulation of leukocyte differentiation
GO:0051241	0.849	negative regulation of multicellular organismal process
GO:0007275	0.836	multicellular organism development
GO:0080090	0.835	regulation of primary metabolic process
GO:0051171	0.834	regulation of nitrogen compound metabolic process
GO:0045580	0.831	regulation of T cell differentiation
GO:0048731	0.828	system development
GO:0045321	0.827	leukocyte activation
GO:0045621	0.824	positive regulation of lymphocyte differentiation
GO:0046634	0.823	regulation of alpha-beta T cell activation
GO:0009892	0.816	negative regulation of metabolic process
GO:0048585	0.812	negative regulation of response to stimulus
GO:0010605	0.809	negative regulation of macromolecule metabolic process
GO:0030154	0.807	cell differentiation
GO:0002695	0.801	negative regulation of leukocyte activation
GO:0031323	0.789	regulation of cellular metabolic process
GO:0009893	0.784	positive regulation of metabolic process
GO:0045582	0.775	positive regulation of T cell differentiation
GO:0051716	0.771	cellular response to stimulus
GO:0010033	0.770	response to organic substance
GO:0010604	0.770	positive regulation of macromolecule metabolic process
GO:0046649	0.750	lymphocyte activation
GO:0048468	0.706	cell development
GO:0032102	0.698	negative regulation of response to external stimulus
GO:0002521	0.690	leukocyte differentiation
GO:2000514	0.676	regulation of CD4-positive, alpha-beta T cell activation
GO:0046637	0.676	regulation of alpha-beta T cell differentiation
GO:0031348	0.661	negative regulation of defense response
GO:0042110	0.649	T cell activation
GO:0007154	0.647	cell communication
GO:0007165	0.641	signal transduction
GO:0002831	0.640	regulation of response to biotic stimulus
GO:0003158	0.624	endothelium development
GO:0030217	0.621	T cell differentiation
GO:0050776	0.620	regulation of immune response
GO:0010556	0.615	regulation of macromolecule biosynthetic process
GO:0031326	0.615	regulation of cellular biosynthetic process
GO:0019219	0.615	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.614	regulation of DNA-templated transcription
GO:1901700	0.609	response to oxygen-containing compound
GO:0043367	0.564	CD4-positive, alpha-beta T cell differentiation
GO:0030855	0.558	epithelial cell differentiation
GO:0002832	0.516	negative regulation of response to biotic stimulus
GO:0051173	0.510	positive regulation of nitrogen compound metabolic process
GO:0045446	0.487	endothelial cell differentiation
GO:0008152	0.476	metabolic process
GO:0051246	0.470	regulation of protein metabolic process
GO:0050687	0.468	negative regulation of defense response to virus
GO:0045472	0.463	response to ether
GO:0048584	0.462	positive regulation of response to stimulus
GO:0001885	0.455	endothelial cell development
GO:0009617	0.431	response to bacterium
GO:0031325	0.429	positive regulation of cellular metabolic process
GO:0071704	0.416	organic substance metabolic process
GO:0007166	0.405	cell surface receptor signaling pathway
GO:0002237	0.400	response to molecule of bacterial origin
GO:0044238	0.393	primary metabolic process
GO:0006950	0.376	response to stress
GO:0007399	0.373	nervous system development
GO:0006807	0.359	nitrogen compound metabolic process
GO:0031399	0.345	regulation of protein modification process
GO:0033993	0.344	response to lipid
GO:0044237	0.330	cellular metabolic process
GO:0006955	0.311	immune response
GO:0009966	0.308	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0005737	0.985	cytoplasm
GO:0071944	0.531	cell periphery
GO:0005886	0.518	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.922	Transferases.
EC:2.7.1.-	0.906	Phosphotransferases with an alcohol group as acceptor.

[back to server]