StarFunc result for job id Q9BZS9

User Input

>input (49 residues)
MPYDQDSFSTLLGFLQASRKYSEFTLKCPICIYVPCQCFAVGFLKQSDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P24384	4.0	26.6	1145	0.265	0.011	PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP22 PE=1 SV=1
2	Q924C1	7.8	25.4	1204	0.306	0.012	XPO5_MOUSE Exportin-5 OS=Mus musculus OX=10090 GN=Xpo5 PE=1 SV=1
3	A8R7E6	8.7	25.4	617	0.224	0.018	CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana OX=3702 GN=CERK1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 42345.XP_008803265.1

Rank	PPI partner	STRING score	Description
1	42345.XP_008787950.1	0.969	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
2	42345.XP_008776063.1	0.896	Chorismate mutase 2-like
3	42345.XP_008780978.1	0.896	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
4	42345.XP_008799664.1	0.896	Chorismate mutase 2-like
5	42345.XP_008793014.1	0.860	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
6	42345.XP_008793955.1	0.860	Arogenate dehydrogenase 2, chloroplastic-like
7	42345.XP_008801901.1	0.860	Arogenate dehydrogenase 2, chloroplastic-like
8	42345.XP_008784801.1	0.812	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 ESTs, 27 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns
9	42345.XP_008789337.1	0.812	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 ESTs, 27 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
10	42345.XP_008789927.1	0.812	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 ESTs, 17 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
11	42345.XP_008785294.1	0.753	Chorismate synthase 2, chloroplastic-like
12	42345.XP_008791524.1	0.753	Chorismate synthase, chloroplastic-like
13	42345.XP_008783401.1	0.751	Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase-like
14	42345.XP_008809314.1	0.751	Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase-like isoform X1
15	42345.XP_008779005.1	0.748	Probable aminotransferase TAT2
16	42345.XP_008783141.1	0.748	Nicotianamine aminotransferase A-like isoform X1
17	42345.XP_008803737.1	0.715	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
18	42345.XP_008777668.1	0.692	P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants
19	42345.XP_008785506.1	0.692	P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants
20	42345.XP_008785254.1	0.638	Phenylalanine ammonia-lyase-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.997	binding
GO:0005515	0.731	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.309	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.869	intracellular anatomical structure
GO:0005737	0.815	cytoplasm
GO:0005829	0.753	cytosol
GO:0043226	0.670	organelle
GO:0043227	0.590	membrane-bounded organelle
GO:0043231	0.541	intracellular membrane-bounded organelle
GO:0005634	0.353	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]