StarFunc result for job id Q9BZV3

User Input

>input (1241 residues)
MIMFPLFGKISLGILIFVLIEGDFPSLTAQTYLSIEEIQEPKSAVSFLLPEESTDLSLAT
KKKQPLDRRETERQWLIRRRRSILFPNGVKICPDESVAEAVANHVKYFKVRVCQEAVWEA
FRTFWDRLPGREEYHYWMNLCEDGVTSIFEMGTNFSESVEHRSLIMKKLTYAKETVSSSE
LSSPVPVGDTSTLGDTTLSVPHPEVDAYEGASESSLERPEESISNEIENVIEEATKPAGE
QIAEFSIHLLGKQYREELQDSSSFHHQHLEEEFISEVENAFTGLPGYKEIRVLEFRSPKE
NDSGVDVYYAVTFNGEAISNTTWDLISLHSNKVENHGLVELDDKPTVVYTISNFRDYIAE
TLQQNFLLGNSSLNPDPDSLQLINVRGVLRHQTEDLVWNTQSSSLQATPSSILDNTFQAA
WPSADESITSSIPPLDFSSGPPSATGRELWSESPLGDLVSTHKLAFPSKMGLSSSPEVLE
VSSLTLHSVTPAVLQTGLPVASEERTSGSHLVEDGLANVEESEDFLSIDSLPSSSFTQPV
PKETIPSMEDSDVSLTSSPYLTSSIPFGLDSLTSKVKDQLKVSPFLPDASMEKELIFDGG
LGSGSGQKVDLITWPWSETSSEKSAEPLSKPWLEDDDSLLPAEIEDKKLVLVDKMDSTDQ
ISKHSKYEHDDRSTHFPEEEPLSGPAVPIFADTAAESASLTLPKHISEVPGVDDYSVTKA
PLILTSVAISASTDKSDQADAILREDMEQITESSNYEWFDSEVSMVKPDMQTLWTILPES
ERVWTRTSSLEKLSRDILASTPQSADRLWLSVTQSTKLPPTTISTLLEDEVIMGVQDISL
ELDRIGTDYYQPEQVQEQNGKVGSYVEMSTSVHSTEMVSVAWPTEGGDDLSYTQTSGALV
VFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNLEILNFRNGSIV
VNSRMKFANSVPPNVNNAVYMILEDFCTTAYNTMNLAIDKYSLDVESGDEANPCKFQACN
EFSECLVNPWSGEAKCRCFPGYLSVEERPCQSLCDLQPDFCLNDGKCDIMPGHGAICRCR
VGENWWYRGKHCEEFVSEPVIIGITIASVVGLLVIFSAIIYFFIRTLQAHHDRSERESPF
SGSSRQPDSLSSIENAVKYNPVYESHRAGCEKYEGPYPQHPFYSSASGDVIGGLSREEIR
QMYESSELSREEIQERMRVLELYANDPEFAAFVREQQVEEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q80XH2	0.356	0.355	0.000	1243	0.713	0.712	Q80XH2.pdb.gz	IMPG2_MOUSE Interphotoreceptor matrix proteoglycan 2 OS=Mus musculus OX=10090 GN=Impg2 PE=1 SV=1
2	AFDB:Q9BZV3	1.000	1.000	0.000	1241	1.000	1.000	Q9BZV3.pdb.gz	IMPG2_HUMAN Interphotoreceptor matrix proteoglycan 2 OS=Homo sapiens OX=9606 GN=IMPG2 PE=1 SV=3
3	AFDB:Q8JIR8	0.154	0.203	2.253E-48	928	0.243	0.325	Q8JIR8.pdb.gz	IMPG1_CHICK Interphotoreceptor matrix proteoglycan 1 OS=Gallus gallus OX=9031 GN=IMPG1 PE=1 SV=1
4	AFDB:A1Z6W9	0.116	0.109	1.058E-12	1363	0.147	0.134	A1Z6W9.pdb.gz	A1Z6W9_DROME Pawn, isoform B OS=Drosophila melanogaster OX=7227 GN=pwn PE=4 SV=2
5	AFDB:Q9H195	0.089	0.089	1.709E-11	1237	0.147	0.147	Q9H195.pdb.gz	MUC3B_HUMAN Mucin-3B OS=Homo sapiens OX=9606 GN=MUC3B PE=2 SV=3
6	AFDB:E9Q7X6	0.073	0.068	5.056E-7	1337	0.163	0.151	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
7	AFDB:Q9ULI3	0.076	0.070	2.685E-6	1381	0.158	0.142	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
8	AFDB:F1QDA1	0.054	0.045	5.307E-4	1547	0.122	0.098	F1QDA1.pdb.gz	F1QDA1_DANRE Aggrecan a OS=Danio rerio OX=7955 GN=acana PE=4 SV=2
9	AFDB:Q6FUJ4	0.068	0.071	1.293E-3	1185	0.140	0.147	Q6FUJ4.pdb.gz	Q6FUJ4_CANGA Candida glabrata strain CBS138 chromosome F complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0F03003g PE=4 SV=1
10	AFDB:Q8IXT5	0.053	0.064	2.255E-3	1001	0.093	0.116	Q8IXT5.pdb.gz	RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2
11	PDB:7q3nU	0.051	0.164	5.199E-3	292	0.018	0.075	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:2xmaE	0.064	0.344	7.675E-3	141	0.014	0.121	2xmaE.pdb.gz	DNA Recognition and the Precleavage State During Single-Stranded DNA Transposition in D. Radiodurans.
13	PDB:3kg0B	0.060	0.451	1.266E-2	98	0.014	0.173	3kg0B.pdb.gz
14	PDB:4er8A	0.067	0.368	2.209E-2	165	0.010	0.079	4er8A.pdb.gz	The processing of repetitive extragenic palindromes: the structure of a repetitive extragenic palindrome bound to its associated nuclease.
15	PDB:2apoA	0.048	0.146	2.918E-2	304	0.012	0.049	2apoA.pdb.gz	The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.
16	PDB:3jd5F	0.058	0.352	2.918E-2	124	0.014	0.137	3jd5F.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
17	PDB:7mpyB	0.061	0.161	6.016E-2	430	0.010	0.028	7mpyB.pdb.gz
18	PDB:3nogA	0.067	0.079	7.516E-2	1012	0.012	0.015	3nogA.pdb.gz
19	PDB:1sgvB	0.051	0.176	8.400E-2	266	0.016	0.075	1sgvB.pdb.gz
20	PDB:2gqqC	0.054	0.283	8.400E-2	157	0.012	0.096	2gqqC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80XH2	0.0	1711	1243	0.716	0.714	IMPG2_MOUSE Interphotoreceptor matrix proteoglycan 2 OS=Mus musculus OX=10090 GN=Impg2 PE=1 SV=1
2	Q9BZV3	0.0	2546	1241	1.000	1.000	IMPG2_HUMAN Interphotoreceptor matrix proteoglycan 2 OS=Homo sapiens OX=9606 GN=IMPG2 PE=1 SV=3
3	Q8JIR8	1.55e-80	287	928	0.115	0.154	IMPG1_CHICK Interphotoreceptor matrix proteoglycan 1 OS=Gallus gallus OX=9031 GN=IMPG1 PE=1 SV=1
4	Q17R60	3.43e-60	224	797	0.098	0.153	IMPG1_HUMAN Interphotoreceptor matrix proteoglycan 1 OS=Homo sapiens OX=9606 GN=IMPG1 PE=1 SV=2
5	Q8R1W8	6.80e-53	202	798	0.077	0.119	IMPG1_MOUSE Interphotoreceptor matrix proteoglycan 1 OS=Mus musculus OX=10090 GN=Impg1 PE=1 SV=1
6	Q685J3	2.00e-11	71.6	4493	0.050	0.014	MUC17_HUMAN Mucin-17 OS=Homo sapiens OX=9606 GN=MUC17 PE=1 SV=2
7	Q71M36	2.74e-11	70.1	566	0.023	0.051	CSPG5_MOUSE Chondroitin sulfate proteoglycan 5 OS=Mus musculus OX=10090 GN=Cspg5 PE=1 SV=2
8	O95196	1.95e-10	67.4	566	0.019	0.042	CSPG5_HUMAN Chondroitin sulfate proteoglycan 5 OS=Homo sapiens OX=9606 GN=CSPG5 PE=1 SV=3
9	Q9ERQ6	2.16e-10	67.4	571	0.019	0.042	CSPG5_RAT Chondroitin sulfate proteoglycan 5 OS=Rattus norvegicus OX=10116 GN=Cspg5 PE=1 SV=1
10	Q16820	5.62e-06	53.1	701	0.022	0.039	MEP1B_HUMAN Meprin A subunit beta OS=Homo sapiens OX=9606 GN=MEP1B PE=1 SV=3
11	P28826	6.83e-05	49.7	704	0.019	0.033	MEP1B_RAT Meprin A subunit beta OS=Rattus norvegicus OX=10116 GN=Mep1b PE=1 SV=3
12	M9NE82	8.58e-05	49.7	8579	0.029	0.004	M9NE82_DROME Dumpy, isoform M OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PEI7	9.67e-05	49.7	15998	0.029	0.002	M9PEI7_DROME Dumpy, isoform Z OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	Q02505	1.09e-04	49.3	3323	0.040	0.015	MUC3A_HUMAN Mucin-3A OS=Homo sapiens OX=9606 GN=MUC3A PE=1 SV=3
15	M9PC48	1.39e-04	48.9	18095	0.029	0.002	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
16	M9PCJ6	1.45e-04	48.9	18641	0.029	0.002	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	Q9H195	1.74e-04	48.5	1237	0.040	0.040	MUC3B_HUMAN Mucin-3B OS=Homo sapiens OX=9606 GN=MUC3B PE=2 SV=3
18	E9PWP7	1.98e-04	48.5	4499	0.044	0.012	E9PWP7_MOUSE Mucin 3, intestinal OS=Mus musculus OX=10090 GN=Muc17 PE=1 SV=4
19	Q61847	2.16e-04	48.1	704	0.019	0.033	MEP1B_MOUSE Meprin A subunit beta OS=Mus musculus OX=10090 GN=Mep1b PE=1 SV=2
20	P33450	3.90e-04	47.4	5147	0.021	0.005	FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster OX=7227 GN=ft PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	0.23	23.1	EGF-like domain
2	PF06024 Orf78	5.2e+02	12.3	Orf78 (ac78)
3	PF01390 SEA	2.3e-20	84.1	SEA domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000193391

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000424243	0.705	Protein eyes shut homolog
2	9606.ENSP00000309606	0.690	Zinc finger protein 408
3	9606.ENSP00000332809	0.686	Uncharacterized protein C2orf71
4	9606.ENSP00000465932	0.655	Progressive rod-cone degeneration protein
5	9606.ENSP00000318373	0.654	Zinc finger protein 513
6	9606.ENSP00000399709	0.631	Bestrophin-1
7	9606.ENSP00000258168	0.621	Beta,beta-carotene 15,15'-dioxygenase
8	9606.ENSP00000230381	0.614	Peripherin-2
9	9606.ENSP00000482306	0.607	Tetratricopeptide repeat protein 8
10	9606.ENSP00000353104	0.603	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
11	9606.ENSP00000286688	0.595	Protein C8orf37
12	9606.ENSP00000255266	0.594	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
13	9606.ENSP00000386647	0.593	Pejvakin
14	9606.ENSP00000230361	0.589	Guanylyl cyclase-activating protein 2
15	9606.ENSP00000390084	0.576	Protein shisa-6 homolog
16	9606.ENSP00000229771	0.570	Tubby-related protein 1
17	9606.ENSP00000341159	0.566	Ceramide kinase-like protein
18	9606.ENSP00000385158	0.565	Protein FAM161A
19	9606.ENSP00000251102	0.564	Cyclic nucleotide-gated cation channel beta-1
20	9606.ENSP00000359245	0.562	Retinal-specific ATP-binding cassette transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005540	1.000	hyaluronic acid binding
GO:0005201	0.996	extracellular matrix structural constituent
GO:0005515	0.857	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.985	multicellular organismal process
GO:0007601	0.952	visual perception
GO:0009987	0.875	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031012	0.999	extracellular matrix
GO:0032991	0.991	protein-containing complex
GO:0016020	0.883	membrane
GO:0005622	0.737	intracellular anatomical structure
GO:0043226	0.732	organelle
GO:0043229	0.651	intracellular organelle
GO:0005886	0.466	plasma membrane
GO:0043227	0.458	membrane-bounded organelle
GO:0043231	0.411	intracellular membrane-bounded organelle
GO:0070013	0.400	intracellular organelle lumen
GO:0005737	0.385	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]