StarFunc result for job id Q9BZW2

User Input

>input (595 residues)
MKFFSYILVYRRFLFVVFTVLVLLPLPIVLHTKEAECAYTLFVVATFWLTEALPLSVTAL
LPSLMLPMFGIMPSKKVASAYFKDFHLLLIGVICLATSIEKWNLHKRIALKMVMMVGVNP
AWLTLGFMSSTAFLSMWLSNTSTAAMVMPIAEAVVQQIINAEAEVEATQMTYFNGSTNHG
LEIDESVNGHEINERKEKTKPVPGYNNDTGKISSKVELEKNSGMRTKYRTKKGHVTRKLT
CLCIAYSSTIGGLTTITGTSTNLIFAEYFNTRYPDCRCLNFGSWFTFSFPAALIILLLSW
IWLQWLFLGFNFKEMFKCGKTKTVQQKACAEVIKQEYQKLGPIRYQEIVTLVLFIIMALL
WFSRDPGFVPGWSALFSEYPGFATDSTVALLIGLLFFLIPAKTLTKTTPTGEIVAFDYSP
LITWKEFQSFMPWDIAILVGGGFALADGCEESGLSKWIGNKLSPLGSLPAWLIILISSLM
VTSLTEVASNPATITLFLPILSPLAEAIHVNPLYILIPSTLCTSFAFLLPVANPPNAIVF
SYGHLKVIDMVKAGLGVNIVGVAVVMLGICTWIVPMFDLYTYPSWAPAMSNETMP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BZW2	1.000	1.000	2.143E-80	595	1.000	1.000	Q9BZW2.pdb.gz	S13A1_HUMAN Solute carrier family 13 member 1 OS=Homo sapiens OX=9606 GN=SLC13A1 PE=1 SV=1
2	AFDB:Q07782	0.921	0.921	5.971E-69	595	0.829	0.829	Q07782.pdb.gz	S13A1_RAT Solute carrier family 13 member 1 OS=Rattus norvegicus OX=10116 GN=Slc13a1 PE=1 SV=1
3	AFDB:A0A2R8QHF0	0.877	0.874	6.881E-55	597	0.543	0.541	A0A2R8QHF0.pdb.gz
4	AFDB:Q9UKG4	0.866	0.824	1.594E-49	626	0.497	0.473	Q9UKG4.pdb.gz	S13A4_HUMAN Solute carrier family 13 member 4 OS=Homo sapiens OX=9606 GN=SLC13A4 PE=1 SV=2
5	AFDB:Q13183	0.874	0.878	5.308E-47	592	0.452	0.454	Q13183.pdb.gz	S13A2_HUMAN Solute carrier family 13 member 2 OS=Homo sapiens OX=9606 GN=SLC13A2 PE=1 SV=1
6	AFDB:Q28615	0.855	0.858	3.138E-46	593	0.437	0.438	Q28615.pdb.gz	S13A2_RABIT Solute carrier family 13 member 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC13A2 PE=1 SV=1
7	AFDB:A0A2R8QQN0	0.855	0.874	3.574E-46	582	0.435	0.445	A0A2R8QQN0.pdb.gz	A0A2R8QQN0_DANRE Solute carrier family 13 member 5a OS=Danio rerio OX=7955 GN=im:7245905 PE=3 SV=1
8	AFDB:Q86YT5	0.874	0.915	8.460E-45	568	0.413	0.433	Q86YT5.pdb.gz	S13A5_HUMAN Na(+)/citrate cotransporter OS=Homo sapiens OX=9606 GN=SLC13A5 PE=1 SV=1
9	AFDB:Q67BT3	0.884	0.919	2.195E-44	572	0.400	0.416	Q67BT3.pdb.gz	S13A5_MOUSE Na(+)/citrate cotransporter OS=Mus musculus OX=10090 GN=Slc13a5 PE=1 SV=1
10	AFDB:P70545	0.858	0.869	5.949E-44	587	0.412	0.417	P70545.pdb.gz	S13A2_RAT Solute carrier family 13 member 2 OS=Rattus norvegicus OX=10116 GN=Slc13a2 PE=1 SV=3
11	PDB:7jsjA	0.739	0.936	5.021E-34	468	0.375	0.476	7jsjA.pdb.gz	Structure and inhibition mechanism of the human citrate transporter NaCT.
12	PDB:7t9gA	0.685	0.909	1.805E-21	445	0.240	0.321	7t9gA.pdb.gz	Structural basis of ion - substrate coupling in the Na + -dependent dicarboxylate transporter VcINDY.
13	PDB:4f35B	0.634	0.901	1.050E-17	414	0.240	0.345	4f35B.pdb.gz	Structure and mechanism of a bacterial sodium-dependent dicarboxylate transporter.
14	PDB:5y50A	0.114	0.135	2.014E-1	448	0.124	0.165	5y50A.pdb.gz
15	PDB:5ykeB	0.108	0.083	2.103E-1	845	0.131	0.092	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
16	PDB:6gs1A	0.122	0.142	2.612E-1	472	0.116	0.146	6gs1A.pdb.gz
17	PDB:5lzrB	0.149	0.133	2.975E-1	697	0.121	0.103	5lzrB.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
18	PDB:8cs9Q	0.116	0.152	3.107E-1	390	0.064	0.097	8cs9Q.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
19	PDB:2wsxA	0.106	0.120	3.388E-1	496	0.113	0.135	2wsxA.pdb.gz	Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.
20	PDB:4jr9A	0.102	0.133	5.700E-1	409	0.124	0.181	4jr9A.pdb.gz	Crystal structure of a nitrate/nitrite exchanger.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q07782	0.0	965	595	0.829	0.829	S13A1_RAT Solute carrier family 13 member 1 OS=Rattus norvegicus OX=10116 GN=Slc13a1 PE=1 SV=1
2	Q6PE27	0.0	647	583	0.548	0.559	Q6PE27_DANRE Solute carrier family 13 (Sodium/sulphate symporters), member 1 OS=Danio rerio OX=7955 GN=sb:cb1073 PE=2 SV=1
3	Q9BZW2	0.0	1210	595	1.000	1.000	S13A1_HUMAN Solute carrier family 13 member 1 OS=Homo sapiens OX=9606 GN=SLC13A1 PE=1 SV=1
4	Q9JHI4	0.0	971	594	0.810	0.811	S13A1_MOUSE Solute carrier family 13 member 1 OS=Mus musculus OX=10090 GN=Slc13a1 PE=1 SV=2
5	Q9UKG4	0.0	572	626	0.486	0.462	S13A4_HUMAN Solute carrier family 13 member 4 OS=Homo sapiens OX=9606 GN=SLC13A4 PE=1 SV=2
6	Q9ES88	4.43e-160	472	586	0.445	0.452	S13A2_MOUSE Solute carrier family 13 member 2 OS=Mus musculus OX=10090 GN=Slc13a2 PE=1 SV=1
7	A0A2R8QQN0	1.16e-159	471	582	0.420	0.430	A0A2R8QQN0_DANRE Solute carrier family 13 member 5a OS=Danio rerio OX=7955 GN=im:7245905 PE=3 SV=1
8	Q28615	1.71e-157	466	593	0.452	0.454	S13A2_RABIT Solute carrier family 13 member 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC13A2 PE=1 SV=1
9	Q13183	7.58e-156	461	592	0.467	0.470	S13A2_HUMAN Solute carrier family 13 member 2 OS=Homo sapiens OX=9606 GN=SLC13A2 PE=1 SV=1
10	Q8WWT9	1.87e-154	458	602	0.413	0.409	S13A3_HUMAN Na(+)/dicarboxylate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC13A3 PE=1 SV=1
11	Q86YT5	1.11e-153	455	568	0.434	0.454	S13A5_HUMAN Na(+)/citrate cotransporter OS=Homo sapiens OX=9606 GN=SLC13A5 PE=1 SV=1
12	P70545	1.91e-152	452	587	0.435	0.441	S13A2_RAT Solute carrier family 13 member 2 OS=Rattus norvegicus OX=10116 GN=Slc13a2 PE=1 SV=3
13	Q91Y63	5.07e-148	442	600	0.403	0.400	S13A3_MOUSE Na(+)/dicarboxylate cotransporter 3 OS=Mus musculus OX=10090 GN=Slc13a3 PE=1 SV=1
14	Q9Z0Z5	1.05e-147	441	600	0.402	0.398	S13A3_RAT Na(+)/dicarboxylate cotransporter 3 OS=Rattus norvegicus OX=10116 GN=Slc13a3 PE=1 SV=1
15	Q67BT3	6.93e-145	432	572	0.412	0.428	S13A5_MOUSE Na(+)/citrate cotransporter OS=Mus musculus OX=10090 GN=Slc13a5 PE=1 SV=1
16	Q8CJ44	6.19e-140	420	572	0.402	0.418	S13A5_RAT Na(+)/citrate cotransporter OS=Rattus norvegicus OX=10116 GN=Slc13a5 PE=1 SV=1
17	Q93655	1.40e-103	327	582	0.341	0.349	NAD1_CAEEL Sodium-dependent low-affinity dicarboxylate transporter 1 OS=Caenorhabditis elegans OX=6239 GN=nac-1 PE=2 SV=3
18	C9J7L4	7.15e-101	314	408	0.286	0.417	C9J7L4_HUMAN Solute carrier family 13 member 3 (Fragment) OS=Homo sapiens OX=9606 GN=SLC13A3 PE=1 SV=8
19	Q9VVT2	2.42e-96	308	590	0.341	0.344	INDY1_DROME Protein I'm not dead yet OS=Drosophila melanogaster OX=7227 GN=Indy PE=2 SV=2
20	Q21339	1.22e-89	290	566	0.308	0.323	NAD3_CAEEL Sodium-dependent high-affinity dicarboxylate transporter 3 OS=Caenorhabditis elegans OX=6239 GN=nac-3 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03600 CitMHS	5.6e-26	103.0	Citrate transporter
2	PF09998 DUF2239	6.5e+02	11.5	Uncharacterized protein conserved in bacteria (DUF2239)
3	PF00939 Na_sulph_symp	1e-92	323.4	Sodium:sulfate symporter transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000194130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286298	0.804	Sulfate transporter
2	9606.ENSP00000397655	0.799	Ankyrin repeat and SOCS box protein 15
3	9606.ENSP00000345873	0.762	Chloride anion exchanger
4	9606.ENSP00000310129	0.745	26S proteasome non-ATPase regulatory subunit 2
5	9606.ENSP00000354721	0.742	Sulfate anion transporter 1
6	9606.ENSP00000262613	0.725	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
7	9606.ENSP00000332656	0.706	Ectonucleotide pyrophosphatase/phosphodiesterase family member 7
8	9606.ENSP00000315006	0.690	Sodium/nucleoside cotransporter 2
9	9606.ENSP00000377424	0.686	Equilibrative nucleoside transporter 1
10	9606.ENSP00000417769	0.679	IQ and ubiquitin-like domain-containing protein
11	9606.ENSP00000416508	0.645	Probable cation-transporting ATPase 13A3
12	9606.ENSP00000265715	0.613	Pendrin
13	9606.ENSP00000379326	0.601	Sodium-coupled monocarboxylate transporter 2
14	9606.ENSP00000311336	0.600	Phospholipid-transporting ATPase IK
15	9606.ENSP00000442397	0.573	Sodium-dependent phosphate transport protein 2C
16	9606.ENSP00000378074	0.568	Sodium/nucleoside cotransporter 1
17	9606.ENSP00000272542	0.566	Sodium-dependent phosphate transporter 1
18	9606.ENSP00000353557	0.566	Solute carrier family 35 member F1
19	9606.ENSP00000244527	0.550	Sodium-dependent phosphate transport protein 1
20	9606.ENSP00000261622	0.542	Large neutral amino acids transporter small subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015116	1.000	sulfate transmembrane transporter activity
GO:0015370	1.000	solute:sodium symporter activity
GO:0008514	0.825	organic anion transmembrane transporter activity
GO:0005342	0.816	organic acid transmembrane transporter activity
GO:0015141	0.810	succinate transmembrane transporter activity
GO:0005488	0.802	binding
GO:0005343	0.778	organic acid:sodium symporter activity
GO:0005515	0.757	protein binding
GO:0015382	0.726	sodium:sulfate symporter activity
GO:0017153	0.351	sodium:dicarboxylate symporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0072348	0.997	sulfur compound transport
GO:0071705	0.996	nitrogen compound transport
GO:0015698	0.995	inorganic anion transport
GO:0009987	0.435	cellular process
GO:0071702	0.377	organic substance transport
GO:0006811	0.362	monoatomic ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0098590	0.802	plasma membrane region
GO:0016324	0.689	apical plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34983	1.000	sulfate(in) = sulfate(out)
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]