StarFunc result for job id Q9BZW8

User Input

>input (370 residues)
MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQ
NGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTAT
FQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAG
NLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSAL
FLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMI
QSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSR
KELENFDVYS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9BZW8	1.000	1.000	4.913E-64	370	1.000	1.000	Q9BZW8.pdb.gz	CD244_HUMAN Natural killer cell receptor 2B4 OS=Homo sapiens OX=9606 GN=CD244 PE=1 SV=2
2	AFDB:Q07763	0.431	0.408	6.365E-34	397	0.516	0.481	Q07763.pdb.gz	CD244_MOUSE Natural killer cell receptor 2B4 OS=Mus musculus OX=10090 GN=Cd244 PE=1 SV=3
3	AFDB:Q13291	0.358	0.386	4.456E-19	335	0.203	0.224	Q13291.pdb.gz	SLAF1_HUMAN Signaling lymphocytic activation molecule OS=Homo sapiens OX=9606 GN=SLAMF1 PE=1 SV=1
4	AFDB:Q01965	0.356	0.235	1.178E-18	654	0.184	0.104	Q01965.pdb.gz	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
5	AFDB:Q9QUM4	0.385	0.409	2.509E-18	343	0.208	0.224	Q9QUM4.pdb.gz	SLAF1_MOUSE Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1
6	AFDB:Q9UIB8	0.360	0.381	6.999E-18	345	0.189	0.203	Q9UIB8.pdb.gz	SLAF5_HUMAN SLAM family member 5 OS=Homo sapiens OX=9606 GN=CD84 PE=1 SV=1
7	AFDB:A4JYL8	0.327	0.266	9.168E-18	475	0.216	0.168	A4JYL8.pdb.gz
8	AFDB:Q8BHK6	0.363	0.394	1.078E-17	333	0.159	0.177	Q8BHK6.pdb.gz	SLAF7_MOUSE SLAM family member 7 OS=Mus musculus OX=10090 GN=Slamf7 PE=1 SV=2
9	AFDB:Q9NQ25	0.358	0.385	1.661E-17	335	0.189	0.209	Q9NQ25.pdb.gz	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
10	AFDB:P08921	0.386	0.408	1.850E-17	344	0.154	0.166	P08921.pdb.gz	CD2_RAT T-cell surface antigen CD2 OS=Rattus norvegicus OX=10116 GN=Cd2 PE=1 SV=2
11	PDB:3c2aL	0.256	0.391	3.260E-9	216	0.097	0.167	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
12	PDB:2qhrL	0.233	0.369	8.617E-9	218	0.095	0.161	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
13	PDB:6vpyL	0.231	0.386	9.095E-9	209	0.084	0.148	6vpyL.pdb.gz
14	PDB:4r2gP	0.242	0.403	1.561E-8	210	0.086	0.152	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
15	PDB:1q0xL	0.239	0.388	2.278E-8	212	0.084	0.146	1q0xL.pdb.gz
16	PDB:4lluB	0.234	0.385	2.537E-8	210	0.086	0.152	4lluB.pdb.gz
17	PDB:1aqkL	0.231	0.368	3.908E-8	216	0.097	0.167	1aqkL.pdb.gz
18	PDB:1jnhA	0.213	0.354	4.125E-8	208	0.084	0.149	1jnhA.pdb.gz	Highly specific anti-estradiol antibodies: structural characterisation and binding diversity.
19	PDB:1gafL	0.239	0.389	6.354E-8	214	0.086	0.150	1gafL.pdb.gz	The immunological evolution of catalysis.
20	PDB:4fqqL	0.224	0.367	6.707E-8	213	0.103	0.178	4fqqL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9BZW8	0.0	766	370	1.000	1.000	CD244_HUMAN Natural killer cell receptor 2B4 OS=Homo sapiens OX=9606 GN=CD244 PE=1 SV=2
2	Q07763	9.96e-115	341	397	0.527	0.491	CD244_MOUSE Natural killer cell receptor 2B4 OS=Mus musculus OX=10090 GN=Cd244 PE=1 SV=3
3	Q13291	1.99e-13	72.8	335	0.162	0.179	SLAF1_HUMAN Signaling lymphocytic activation molecule OS=Homo sapiens OX=9606 GN=SLAMF1 PE=1 SV=1
4	Q9UIB8	9.25e-10	61.6	345	0.232	0.249	SLAF5_HUMAN SLAM family member 5 OS=Homo sapiens OX=9606 GN=CD84 PE=1 SV=1
5	Q9QUM4	1.24e-09	61.2	343	0.162	0.175	SLAF1_MOUSE Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1
6	Q18PI6	4.90e-09	59.3	329	0.176	0.198	SLAF5_MOUSE SLAM family member 5 OS=Mus musculus OX=10090 GN=Cd84 PE=1 SV=1
7	Q9HBG7	1.88e-08	58.5	655	0.124	0.070	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
8	P18181	3.66e-07	53.1	240	0.119	0.183	CD48_MOUSE CD48 antigen OS=Mus musculus OX=10090 GN=Cd48 PE=1 SV=1
9	Q9P0V8	2.39e-06	50.8	285	0.130	0.168	SLAF8_HUMAN SLAM family member 8 OS=Homo sapiens OX=9606 GN=SLAMF8 PE=1 SV=1
10	P10252	3.36e-06	50.1	240	0.122	0.188	CD48_RAT CD48 antigen OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1
11	Q9ET39	1.14e-05	49.3	351	0.168	0.177	SLAF6_MOUSE SLAM family member 6 OS=Mus musculus OX=10090 GN=Slamf6 PE=1 SV=1
12	Q9D3G2	1.45e-05	48.5	278	0.157	0.209	SLAF8_MOUSE SLAM family member 8 OS=Mus musculus OX=10090 GN=Slamf8 PE=2 SV=2
13	P31809	1.98e-05	48.9	521	0.108	0.077	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
14	Q9D780	2.94e-05	47.8	285	0.100	0.130	SLAF9_MOUSE SLAM family member 9 OS=Mus musculus OX=10090 GN=Slamf9 PE=2 SV=2
15	Q925P2	7.94e-05	47.0	520	0.105	0.075	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3
16	A2ASS6	2.92e-04	45.4	35213	0.103	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
17	Q8WZ42	3.24e-04	45.4	34350	0.105	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
18	A0A8I5ZUN3	3.65e-04	45.4	35375	0.103	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
19	P13688	7.34e-04	43.9	526	0.111	0.078	CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CEACAM1 PE=1 SV=2
20	P09326	0.001	42.4	243	0.114	0.173	CD48_HUMAN CD48 antigen OS=Homo sapiens OX=9606 GN=CD48 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00029 Connexin	2e+02	13.2	Connexin
2	PF15096 G6B	5.2e+02	11.7	G6B family
3	PF20418 Herpes_gE_N	37	15.6	Alphaherpesvirus glycoprotein E N-terminal
4	PF07679 I-set	0.002	29.5	Immunoglobulin I-set domain
5	PF00047 ig	1.6e+02	13.9	Immunoglobulin domain
6	PF13895 Ig_2	9e-05	34.0	Immunoglobulin domain
7	PF13927 Ig_3	0.03	26.2	Immunoglobulin domain
8	PF11465 Receptor_2B4	3.4e-48	173.7	Natural killer cell receptor 2B4
9	PF13908 Shisa	2e+02	13.4	Wnt and FGF inhibitory regulator
10	PF12191 stn_TNFRSF12A	1.2e+02	14.4	Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain
11	PF14979 TMEM52	4.7e+02	12.2	Transmembrane 52
12	PF07686 V-set	0.0012	30.4	Immunoglobulin V-set domain
13	PF11669 WBP-1	2.4e+02	13.9	WW domain-binding protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357012

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484431	0.999	CD48 antigen
2	9606.ENSP00000360181	0.993	SH2 domain-containing protein 1A
3	9606.ENSP00000356906	0.978	SH2 domain-containing protein 1B
4	9606.ENSP00000346671	0.934	Tyrosine-protein kinase Fyn
5	9606.ENSP00000340944	0.933	Tyrosine-protein phosphatase non-receptor type 11
6	9606.ENSP00000320147	0.891	Histone-lysine N-methyltransferase EZH2
7	9606.ENSP00000240618	0.805	Killer cell lectin-like receptor subfamily K, member 1
8	9606.ENSP00000405338	0.771	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
9	9606.ENSP00000422168	0.767	SH3 domain-binding protein 2
10	9606.ENSP00000280200	0.765	CD226 antigen
11	9606.ENSP00000235933	0.751	CD160 antigen
12	9606.ENSP00000357036	0.749	SLAM family member 6
13	9606.ENSP00000480609	0.736	annotation not available
14	9606.ENSP00000411355	0.729	Receptor-type tyrosine-protein phosphatase C
15	9606.ENSP00000342156	0.716	Natural cytotoxicity triggering receptor 3
16	9606.ENSP00000398568	0.710	Perforin-1
17	9606.ENSP00000291890	0.709	Natural cytotoxicity triggering receptor 1
18	9606.ENSP00000312002	0.707	Hepatitis A virus cellular receptor 2
19	9606.ENSP00000249442	0.698	Metaxin-2
20	9606.ENSP00000246551	0.697	Hematopoietic cell signal transducer

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042287	0.986	MHC protein binding
GO:0042288	0.977	MHC class I protein binding
GO:0038023	0.976	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0048518	0.996	positive regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0032501	0.985	multicellular organismal process
GO:0002376	0.983	immune system process
GO:0048522	0.979	positive regulation of cellular process
GO:0002682	0.958	regulation of immune system process
GO:0001775	0.954	cell activation
GO:0002697	0.949	regulation of immune effector process
GO:0046649	0.940	lymphocyte activation
GO:0051240	0.933	positive regulation of multicellular organismal process
GO:0051716	0.932	cellular response to stimulus
GO:0019222	0.928	regulation of metabolic process
GO:0001817	0.915	regulation of cytokine production
GO:0002684	0.913	positive regulation of immune system process
GO:0007165	0.906	signal transduction
GO:0009893	0.904	positive regulation of metabolic process
GO:0006955	0.868	immune response
GO:0001819	0.861	positive regulation of cytokine production
GO:0080090	0.857	regulation of primary metabolic process
GO:0031323	0.836	regulation of cellular metabolic process
GO:0002252	0.817	immune effector process
GO:0009889	0.789	regulation of biosynthetic process
GO:0031325	0.748	positive regulation of cellular metabolic process
GO:0002285	0.730	lymphocyte activation involved in immune response
GO:0006109	0.715	regulation of carbohydrate metabolic process
GO:0048583	0.688	regulation of response to stimulus
GO:0030101	0.675	natural killer cell activation
GO:0002699	0.515	positive regulation of immune effector process
GO:1902930	0.471	regulation of alcohol biosynthetic process
GO:0010675	0.461	regulation of cellular carbohydrate metabolic process
GO:0032649	0.428	regulation of type II interferon production
GO:0048584	0.421	positive regulation of response to stimulus
GO:0009891	0.408	positive regulation of biosynthetic process
GO:0002694	0.376	regulation of leukocyte activation
GO:0048519	0.337	negative regulation of biological process
GO:1902932	0.330	positive regulation of alcohol biosynthetic process
GO:0051249	0.322	regulation of lymphocyte activation
GO:0050776	0.321	regulation of immune response
GO:0051174	0.314	regulation of phosphorus metabolic process
GO:0043255	0.314	regulation of carbohydrate biosynthetic process
GO:0045913	0.306	positive regulation of carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.998	cell surface
GO:0098552	0.922	side of membrane
GO:0009897	0.911	external side of plasma membrane
GO:0005622	0.867	intracellular anatomical structure
GO:0043226	0.865	organelle
GO:0043227	0.793	membrane-bounded organelle
GO:0043229	0.680	intracellular organelle
GO:0043231	0.604	intracellular membrane-bounded organelle
GO:0005737	0.513	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]