StarFunc result for job id Q9BZX2

User Input

>input (261 residues)
MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILS
QDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRK
EETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQ
ILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNG
CLNGYTPSRKRQASESSSRPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99PM9	0.875	0.875	5.601E-50	261	0.981	0.981	Q99PM9.pdb.gz	UCK2_MOUSE Uridine-cytidine kinase 2 OS=Mus musculus OX=10090 GN=Uck2 PE=1 SV=1
2	AFDB:P52623	0.841	0.793	1.103E-40	277	0.716	0.675	P52623.pdb.gz	UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus OX=10090 GN=Uck1 PE=1 SV=2
3	PDB:6pwzB	0.786	0.948	2.086E-38	215	0.824	1.000	6pwzB.pdb.gz	Incorporation of novel azido-nucleotides into RNA
4	AFDB:Q9FKS0	0.767	0.415	6.572E-31	486	0.441	0.237	Q9FKS0.pdb.gz	UKL1_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL1 PE=1 SV=1
5	AFDB:Q9NWZ5	0.780	0.378	1.758E-30	548	0.433	0.206	Q9NWZ5.pdb.gz	UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1 PE=1 SV=2
6	AFDB:Q8VYB2	0.773	0.437	7.039E-29	466	0.433	0.242	Q8VYB2.pdb.gz	UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=UKL3 PE=2 SV=1
7	AFDB:H2L2A8	0.775	0.360	2.072E-27	569	0.414	0.190	H2L2A8.pdb.gz	H2L2A8_CAEEL Uridine kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_F19B6.1 PE=1 SV=1
8	AFDB:A0A0S2Z5Y6	0.693	0.858	2.281E-26	210	0.594	0.738	A0A0S2Z5Y6.pdb.gz	A0A0S2Z5Y6_HUMAN uridine/cytidine kinase (Fragment) OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1
9	AFDB:P67413	0.753	0.924	8.823E-26	212	0.326	0.401	P67413.pdb.gz	URK_STRPN Uridine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=udk PE=1 SV=1
10	AFDB:P27515	0.759	0.400	1.200E-25	501	0.352	0.184	P27515.pdb.gz	URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URK1 PE=1 SV=1
11	AFDB:O74427	0.776	0.451	1.276E-25	454	0.356	0.205	O74427.pdb.gz	URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urk1 PE=3 SV=1
12	PDB:2gesA	0.608	0.523	2.927E-12	308	0.184	0.156	2gesA.pdb.gz	Invariance and variability in bacterial PanK: a study based on the crystal structure of Mycobacterium tuberculosis PanK.
13	PDB:6h7gA	0.592	0.465	3.310E-12	340	0.188	0.144	6h7gA.pdb.gz
14	PDB:5xmbB	0.613	0.600	4.787E-12	267	0.180	0.176	5xmbB.pdb.gz
15	PDB:1esmA	0.611	0.519	4.658E-11	311	0.172	0.145	1esmA.pdb.gz	Structural basis for the feedback regulation of Escherichia coli pantothenate kinase by coenzyme A.
16	PDB:1odfA	0.520	0.490	2.868E-9	280	0.176	0.164	1odfA.pdb.gz
17	PDB:2p0eA	0.478	0.625	2.625E-8	190	0.165	0.226	2p0eA.pdb.gz	Nicotinamide Riboside Kinase Structures Reveal New Pathways to NAD(+).
18	PDB:1t3hC	0.410	0.540	3.596E-6	187	0.146	0.203	1t3hC.pdb.gz
19	PDB:1qf9A	0.356	0.453	5.530E-6	194	0.149	0.201	1qf9A.pdb.gz	pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog.
20	PDB:1ukyA	0.316	0.397	1.573E-5	196	0.165	0.219	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99PM9	0.0	525	261	0.981	0.981	UCK2_MOUSE Uridine-cytidine kinase 2 OS=Mus musculus OX=10090 GN=Uck2 PE=1 SV=1
2	Q9BZX2	0.0	538	261	1.000	1.000	UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2 PE=1 SV=1
3	Q9QYG8	0.0	525	261	0.981	0.981	UCK2_RAT Uridine-cytidine kinase 2 OS=Rattus norvegicus OX=10116 GN=Uck2 PE=2 SV=2
4	P52623	1.65e-131	374	277	0.724	0.682	UCK1_MOUSE Uridine-cytidine kinase 1 OS=Mus musculus OX=10090 GN=Uck1 PE=1 SV=2
5	Q9HA47	8.34e-131	373	277	0.709	0.668	UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1
6	A0A0S2Z5Y6	4.51e-109	315	210	0.586	0.729	A0A0S2Z5Y6_HUMAN uridine/cytidine kinase (Fragment) OS=Homo sapiens OX=9606 GN=UCK1 PE=1 SV=1
7	Q9NWZ5	5.24e-74	237	548	0.425	0.203	UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1 PE=1 SV=2
8	Q9FKS0	3.24e-73	233	486	0.441	0.237	UKL1_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL1 PE=1 SV=1
9	Q9LK34	4.53e-73	233	483	0.444	0.240	UKL2_ARATH Uridine/cytidine kinase UKL1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UKL2 PE=1 SV=1
10	H2L2A8	3.67e-71	230	569	0.418	0.192	H2L2A8_CAEEL Uridine kinase OS=Caenorhabditis elegans OX=6239 GN=CELE_F19B6.1 PE=1 SV=1
11	Q8VYB2	8.43e-68	218	466	0.421	0.236	UKL3_ARATH Uridine kinase-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=UKL3 PE=2 SV=1
12	O74427	1.47e-53	181	454	0.341	0.196	URK1_SCHPO Uridine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=urk1 PE=3 SV=1
13	P0A8F4	4.74e-48	160	213	0.291	0.357	URK_ECOLI Uridine kinase OS=Escherichia coli (strain K12) OX=83333 GN=udk PE=3 SV=1
14	P67413	6.49e-47	157	212	0.287	0.354	URK_STRPN Uridine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=udk PE=1 SV=1
15	P27515	5.82e-46	162	501	0.345	0.180	URK1_YEAST Uridine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URK1 PE=1 SV=1
16	Q9C664	2.09e-20	92.4	674	0.245	0.095	TTM2_ARATH Inorganic pyrophosphatase TTM2 OS=Arabidopsis thaliana OX=3702 GN=TTM2 PE=1 SV=1
17	Q9C9B9	3.00e-17	83.2	643	0.215	0.087	TTM1_ARATH Inorganic pyrophosphatase TTM1 OS=Arabidopsis thaliana OX=3702 GN=TTM1 PE=1 SV=1
18	P25697	3.51e-15	76.6	395	0.207	0.137	KPPR_ARATH Phosphoribulokinase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g32060 PE=1 SV=1
19	P19824	1.15e-14	75.1	375	0.211	0.147	KPPR_CHLRE Phosphoribulokinase, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=PRKA PE=1 SV=1
20	O94642	5.29e-14	73.2	389	0.238	0.159	TAD2_SCHPO tRNA-specific adenosine deaminase subunit tad2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tad2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	5.3e+02	12.4	AAA domain
2	PF13238 AAA_18	2.2	20.3	AAA domain
3	PF01121 CoaE	0.008	27.4	Dephospho-CoA kinase
4	PF02224 Cytidylate_kin	65	14.7	Cytidylate kinase
5	PF00485 PRK	9.5e-51	183.9	Phosphoribulokinase / Uridine kinase family
6	PF09025 T3SS_needle_reg	2.8e+02	12.9	YopR, type III needle-polymerisation regulator
7	PF06414 Zeta_toxin	26	15.6	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000006992

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000017112	0.997	This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis
2	60711.ENSCSAP00000007115	0.986	Uracil phosphoribosyltransferase (FUR1) homolog (S. cerevisiae)
3	60711.ENSCSAP00000011906	0.974	Catalyzes the reversible phosphorylytic cleavage of uridine and deoxyuridine to uracil and ribose- or deoxyribose-1-phosphate. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
4	60711.ENSCSAP00000004030	0.966	Uridine monophosphate synthetase
5	60711.ENSCSAP00000016765	0.957	Catalyzes the phosphorylation of pyrimidine nucleoside monophosphates at the expense of ATP. Plays an important role in de novo pyrimidine nucleotide biosynthesis. Has preference for UMP and CMP as phosphate acceptors. Also displays broad nucleoside diphosphate kinase activity
6	60711.ENSCSAP00000010985	0.947	Uridine-cytidine kinase 1
7	60711.ENSCSAP00000012719	0.927	Uridine-cytidine kinase 1-like 1
8	60711.ENSCSAP00000012961	0.919	Ectonucleoside triphosphate diphosphohydrolase 3
9	60711.ENSCSAP00000003310	0.914	Cytidine monophosphate (UMP-CMP) kinase 2, mitochondrial
10	60711.ENSCSAP00000002443	0.913	Ectonucleoside triphosphate diphosphohydrolase 1
11	60711.ENSCSAP00000012814	0.913	Ectonucleoside triphosphate diphosphohydrolase 8
12	60711.ENSCSAP00000012716	0.902	Ectonucleotide pyrophosphatase/phosphodiesterase 3
13	60711.ENSCSAP00000012721	0.901	Ectonucleotide pyrophosphatase/phosphodiesterase 1
14	60711.ENSCSAP00000005917	0.874	Activation-induced cytidine deaminase
15	60711.ENSCSAP00000012398	0.842	RAB28, member RAS oncogene family
16	60711.ENSCSAP00000016404	0.801	Membrane associated guanylate kinase, WW and PDZ domain containing 3
17	60711.ENSCSAP00000013118	0.767	Adenosine deaminase, tRNA-specific 2
18	60711.ENSCSAP00000012481	0.765	Ribose 5-phosphate isomerase A
19	60711.ENSCSAP00000006176	0.763	Belongs to the ribulose-phosphate 3-epimerase family.
20	60711.ENSCSAP00000002151	0.759	PAS domain containing serine/threonine kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019206	1.000	nucleoside kinase activity
GO:0004849	0.932	uridine kinase activity
GO:0042802	0.890	identical protein binding
GO:0016773	0.722	phosphotransferase activity, alcohol group as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0006807	0.998	nitrogen compound metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0009117	0.989	nucleotide metabolic process
GO:1901135	0.987	carbohydrate derivative metabolic process
GO:0072527	0.987	pyrimidine-containing compound metabolic process
GO:0009259	0.976	ribonucleotide metabolic process
GO:0009165	0.976	nucleotide biosynthetic process
GO:0006220	0.967	pyrimidine nucleotide metabolic process
GO:0009123	0.955	nucleoside monophosphate metabolic process
GO:0009218	0.955	pyrimidine ribonucleotide metabolic process
GO:0009129	0.952	pyrimidine nucleoside monophosphate metabolic process
GO:0009161	0.949	ribonucleoside monophosphate metabolic process
GO:1901566	0.942	organonitrogen compound biosynthetic process
GO:1901137	0.938	carbohydrate derivative biosynthetic process
GO:0043173	0.927	nucleotide salvage
GO:0009260	0.926	ribonucleotide biosynthetic process
GO:0009124	0.902	nucleoside monophosphate biosynthetic process
GO:0009141	0.882	nucleoside triphosphate metabolic process
GO:0072528	0.875	pyrimidine-containing compound biosynthetic process
GO:0006221	0.870	pyrimidine nucleotide biosynthetic process
GO:0009156	0.830	ribonucleoside monophosphate biosynthetic process
GO:0009199	0.778	ribonucleoside triphosphate metabolic process
GO:0009142	0.757	nucleoside triphosphate biosynthetic process
GO:0009201	0.642	ribonucleoside triphosphate biosynthetic process
GO:0050896	0.310	response to stimulus
GO:0009220	0.309	pyrimidine ribonucleotide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043227	0.972	membrane-bounded organelle
GO:0043231	0.952	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	1.000	Transferring phosphorus-containing groups.
RHEA:16825	0.932	ATP + uridine = ADP + H(+) + UMP
EC:2.7.1.48	0.932	uridine/cytidine kinase.
EC:2.7.1.-	0.722	Phosphotransferases with an alcohol group as acceptor.

[back to server]