StarFunc result for job id Q9BZY9

User Input

>input (425 residues)
MASGQFVNKLQEEVICPICLDILQKPVTIDCGHNFCLKCITQIGETSCGFFKCPLCKTSV
RKNAIRFNSLLRNLVEKIQALQASEVQSKRKEATCPRHQEMFHYFCEDDGKFLCFVCRES
KDHKSHNVSLIEEAAQNYQGQIQEQIQVLQQKEKETVQVKAQGVHRVDVFTDQVEHEKQR
ILTEFELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQN
MPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQAD
RKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHS
LFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFC
EVPSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2L6J1	0.605	0.605	1.416E-65	425	1.000	1.000	Q2L6J1.pdb.gz	Q2L6J1_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=TRIM31 PE=1 SV=1
2	AFDB:Q8R0K2	0.683	0.579	6.642E-35	507	0.419	0.351	Q8R0K2.pdb.gz	TRI31_MOUSE E3 ubiquitin-protein ligase TRIM31 OS=Mus musculus OX=10090 GN=Trim31 PE=1 SV=1
3	AFDB:Q12899	0.468	0.375	2.777E-24	539	0.240	0.189	Q12899.pdb.gz	TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens OX=9606 GN=TRIM26 PE=1 SV=1
4	AFDB:Q9UDY6	0.449	0.405	8.019E-24	481	0.231	0.204	Q9UDY6.pdb.gz	TRI10_HUMAN Tripartite motif-containing protein 10 OS=Homo sapiens OX=9606 GN=TRIM10 PE=1 SV=3
5	AFDB:Q9WUH5	0.444	0.393	1.602E-22	489	0.228	0.198	Q9WUH5.pdb.gz	TRI10_MOUSE Tripartite motif-containing protein 10 OS=Mus musculus OX=10090 GN=Trim10 PE=2 SV=2
6	AFDB:Q99PN3	0.455	0.364	2.188E-22	545	0.226	0.176	Q99PN3.pdb.gz	TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus OX=10090 GN=Trim26 PE=2 SV=3
7	AFDB:Q9C029	0.455	0.384	3.201E-21	511	0.184	0.153	Q9C029.pdb.gz	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
8	AFDB:Q923T7	0.459	0.390	5.973E-21	510	0.195	0.163	Q923T7.pdb.gz	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
9	AFDB:Q5NCC9	0.461	0.411	8.684E-21	485	0.193	0.169	Q5NCC9.pdb.gz	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
10	AFDB:Q9C035	0.379	0.333	1.836E-20	493	0.195	0.168	Q9C035.pdb.gz	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
11	PDB:4tn3B	0.339	0.390	7.485E-8	362	0.099	0.116	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
12	PDB:7z36B	0.267	0.256	7.485E-8	446	0.118	0.112	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
13	PDB:7jzvA	0.177	0.291	8.628E-5	253	0.056	0.095	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
14	PDB:4r8pL	0.144	0.236	1.254E-4	254	0.061	0.102	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:5gm6a	0.131	0.416	6.003E-3	123	0.040	0.138	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:5dkaA	0.122	0.500	7.238E-3	96	0.047	0.208	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
17	PDB:7qcdC	0.153	0.237	9.888E-3	267	0.045	0.071	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:4kblA	0.104	0.111	5.672E-2	395	0.080	0.086	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
19	PDB:8a3tU	0.104	0.334	1.539E-1	114	0.045	0.167	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:5a31B	0.103	0.449	2.699E-1	84	0.031	0.155	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2L6J1	0.0	882	425	1.000	1.000	Q2L6J1_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=TRIM31 PE=1 SV=1
2	Q9BZY9	0.0	882	425	1.000	1.000	TRI31_HUMAN E3 ubiquitin-protein ligase TRIM31 OS=Homo sapiens OX=9606 GN=TRIM31 PE=1 SV=2
3	Q8R0K2	1.15e-116	352	507	0.426	0.357	TRI31_MOUSE E3 ubiquitin-protein ligase TRIM31 OS=Mus musculus OX=10090 GN=Trim31 PE=1 SV=1
4	Q12899	1.02e-50	181	539	0.249	0.197	TRI26_HUMAN Tripartite motif-containing protein 26 OS=Homo sapiens OX=9606 GN=TRIM26 PE=1 SV=1
5	Q9UDY6	4.76e-48	172	481	0.231	0.204	TRI10_HUMAN Tripartite motif-containing protein 10 OS=Homo sapiens OX=9606 GN=TRIM10 PE=1 SV=3
6	Q99PN3	8.57e-44	162	545	0.238	0.185	TRI26_MOUSE Tripartite motif-containing protein 26 OS=Mus musculus OX=10090 GN=Trim26 PE=2 SV=3
7	Q9WUH5	3.42e-43	159	489	0.231	0.200	TRI10_MOUSE Tripartite motif-containing protein 10 OS=Mus musculus OX=10090 GN=Trim10 PE=2 SV=2
8	A0A1U9X8R9	8.00e-43	159	513	0.214	0.177	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
9	P14373	8.00e-43	159	513	0.214	0.177	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1
10	A0A096LP39	2.90e-41	154	503	0.228	0.193	A0A096LP39_HUMAN Ribonuclease P protein subunit p21 OS=Homo sapiens OX=9606 GN=TRIM39-RPP21 PE=1 SV=1
11	Q62158	4.89e-41	154	513	0.209	0.173	TRI27_MOUSE Zinc finger protein RFP OS=Mus musculus OX=10090 GN=Trim27 PE=1 SV=2
12	Q9C030	1.06e-38	147	488	0.209	0.182	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
13	Q8BGE7	1.23e-38	147	488	0.214	0.186	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
14	Q9C035	2.08e-38	147	493	0.212	0.183	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
15	Q5NCC9	1.04e-37	144	485	0.216	0.190	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
16	Q6AZZ1	3.54e-37	143	485	0.205	0.179	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
17	A2AAZ6	3.74e-37	138	260	0.179	0.292	A2AAZ6_HUMAN E3 ubiquitin-protein ligase TRIM39 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM39 PE=4 SV=8
18	A0A024RCP5	1.11e-36	142	518	0.195	0.160	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
19	Q9HCM9	1.11e-36	142	518	0.195	0.160	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
20	Q99PQ2	2.16e-36	140	467	0.212	0.193	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	17	16.8	Baculovirus immediate-early protein (IE-0)
2	PF00589 Phage_integrase	2.7e+02	12.7	Phage integrase family
3	PF14447 Prok-RING_4	8.2e+02	11.3	Prokaryotic RING finger family 4
4	PF01974 tRNA_int_endo	5.7e+02	12.0	tRNA intron endonuclease, catalytic C-terminal domain
5	PF00643 zf-B_box	1.2e-05	36.6	B-box zinc finger
6	PF00097 zf-C3HC4	2.9e-05	35.1	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	0.001	30.1	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	0.0099	27.0	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	3.8e-09	47.8	zinc finger of C3HC4-type, RING
10	PF13639 zf-RING_2	0.011	27.4	Ring finger domain
11	PF14634 zf-RING_5	17	16.8	zinc-RING finger domain
12	PF14835 zf-RING_6	1.3	20.2	zf-RING of BARD1-type protein
13	PF13445 zf-RING_UBOX	2.1e-05	35.7	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365924

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401980	0.871	Mitochondrial antiviral-signaling protein
2	9606.ENSP00000337383	0.756	NACHT, LRR and PYD domains-containing protein 3
3	9606.ENSP00000335261	0.724	Trimethyllysine dioxygenase, mitochondrial
4	9606.ENSP00000349085	0.679	Melanoma-associated antigen 1
5	9606.ENSP00000295756	0.652	T-cell receptor-associated transmembrane adapter 1
6	9606.ENSP00000361207	0.651	Growth hormone-inducible transmembrane protein
7	9606.ENSP00000347088	0.641	LARGE xylosyl- and glucuronyltransferase 1
8	9606.ENSP00000373772	0.625	E3 ubiquitin-protein ligase BRE1A
9	9606.ENSP00000299413	0.621	Tripartite motif-containing protein 44
10	9606.ENSP00000259050	0.617	E3 ubiquitin-protein ligase MARCH7
11	9606.ENSP00000263182	0.601	Gamma-butyrobetaine dioxygenase
12	9606.ENSP00000351250	0.587	E3 ubiquitin-protein ligase TRIM33
13	9606.ENSP00000419454	0.582	Probable E3 ubiquitin-protein ligase RNF183
14	9606.ENSP00000398523	0.581	Calcium-binding and coiled-coil domain-containing protein 2
15	9606.ENSP00000343129	0.568	Tripartite motif-containing protein 29
16	9606.ENSP00000344208	0.558	Tripartite motif-containing protein 14
17	9606.ENSP00000364235	0.547	E3 ubiquitin-protein ligase RNF5
18	9606.ENSP00000358151	0.530	Histone H2B type 2-E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.981	catalytic activity
GO:0019787	0.968	ubiquitin-like protein transferase activity
GO:0004842	0.964	ubiquitin-protein transferase activity
GO:0061659	0.633	ubiquitin-like protein ligase activity
GO:0061630	0.623	ubiquitin protein ligase activity
GO:0042802	0.488	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0098542	0.993	defense response to other organism
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0050792	0.989	regulation of viral process
GO:0019222	0.986	regulation of metabolic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0009987	0.983	cellular process
GO:0051171	0.983	regulation of nitrogen compound metabolic process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:0048525	0.975	negative regulation of viral process
GO:0080090	0.970	regulation of primary metabolic process
GO:0032446	0.969	protein modification by small protein conjugation
GO:0010468	0.962	regulation of gene expression
GO:0016567	0.961	protein ubiquitination
GO:0045087	0.953	innate immune response
GO:0000209	0.949	protein polyubiquitination
GO:0051607	0.948	defense response to virus
GO:1903900	0.932	regulation of viral life cycle
GO:0019219	0.916	regulation of nucleobase-containing compound metabolic process
GO:0044237	0.913	cellular metabolic process
GO:0010556	0.913	regulation of macromolecule biosynthetic process
GO:0051252	0.907	regulation of RNA metabolic process
GO:0031326	0.901	regulation of cellular biosynthetic process
GO:0006355	0.887	regulation of DNA-templated transcription
GO:0048523	0.850	negative regulation of cellular process
GO:0044260	0.803	cellular macromolecule metabolic process
GO:0070936	0.793	protein K48-linked ubiquitination
GO:0044248	0.729	cellular catabolic process
GO:0140374	0.722	antiviral innate immune response
GO:0051090	0.713	regulation of DNA-binding transcription factor activity
GO:0030163	0.703	protein catabolic process
GO:0006508	0.688	proteolysis
GO:0051603	0.664	proteolysis involved in protein catabolic process
GO:0019941	0.612	modification-dependent protein catabolic process
GO:0043903	0.556	regulation of biological process involved in symbiotic interaction
GO:0046596	0.549	regulation of viral entry into host cell
GO:1903901	0.537	negative regulation of viral life cycle
GO:0048518	0.521	positive regulation of biological process
GO:0043254	0.475	regulation of protein-containing complex assembly
GO:0006511	0.442	ubiquitin-dependent protein catabolic process
GO:0048583	0.404	regulation of response to stimulus
GO:0044093	0.343	positive regulation of molecular function
GO:0048522	0.330	positive regulation of cellular process
GO:0031333	0.330	negative regulation of protein-containing complex assembly
GO:0051091	0.317	positive regulation of DNA-binding transcription factor activity
GO:0009893	0.302	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005829	0.975	cytosol
GO:0005739	0.949	mitochondrion
GO:0016020	0.758	membrane
GO:0005634	0.441	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.968	Transferases.

[back to server]