StarFunc result for job id Q9BZZ2

User Input

>input (1709 residues)
MGFLPKLLLLASFFPAGQASWGVSSPQDVQGVKGSCLLIPCIFSFPADVEVPDGITAIWY
YDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEIS
EVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYVCLQEQVRLQWQGQDP
ARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
VKILLSPSGRNILPGELVTLTCQVNSSYPAVSSIKWLKDGVRLQTKTGVLHLPQAAWSDA
GVYTCQAENGVGSLVSPPISLHIFMAEVQVSPAGPILENQTVTLVCNTPNEAPSDLRYSW
YKNHVLLEDAHSHTLRLHLATRADTGFYFCEVQNVHGSERSGPVSVVVNHPPLTPVLTAF
LETQAGLVGILHCSVVSEPLATLVLSHGGHILASTSGDSDHSPRFSGTSGPNSLRLEIRD
LEETDSGEYKCSATNSLGNATSTLDFHANAARLLISPAAEVVEGQAVTLSCRSGLSPTPD
ARFSWYLNGALLHEGPGSSLLLPAASSTDAGSYHCRARDGHSASGPSSPAVLTVLYPPRQ
PTFTTRLDLDAAGAGAGRRGLLLCRVDSDPPARLQLLHKDRVVATSLPSGGGCSTCGGCS
PRMKVTKAPNLLRVEIHNPLLEEEGLYLCEASNALGNASTSATFNGQATVLAIAPSHTLQ
EGTEANLTCNVSREAAGSPANFSWFRNGVLWAQGPLETVTLLPVARTDAALYACRILTEA
GAQLSTPVLLSVLYPPDRPKLSALLDMGQGHMALFICTVDSRPLALLALFHGEHLLATSL
GPQVPSHGRFQAKAEANSLKLEVRELGLGDSGSYRCEATNVLGSSNTSLFFQVRGAWVQV
SPSPELQEGQAVVLSCQVHTGVPEGTSYRWYRDGQPLQESTSATLRFAAITLTQAGAYHC
QAQAPGSATTSLAAPISLHVSYAPRHVTLTTLMDTGPGRLGLLLCRVDSDPPAQLRLLHG
DRLVASTLQGVGGPEGSSPRLHVAVAPNTLRLEIHGAMLEDEGVYICEASNTLGQASASA
DFDAQAVNVQVWPGATVREGQLVNLTCLVWTTHPAQLTYTWYQDGQQRLDAHSIPLPNVT
VRDATSYRCGVGPPGRAPRLSRPITLDVLYAPRNLRLTYLLESHGGQLALVLCTVDSRPP
AQLALSHAGRLLASSTAASVPNTLRLELRGPQPRDEGFYSCSARSPLGQANTSLELRLEG
VRVILAPEAAVPEGAPITVTCADPAAHAPTLYTWYHNGRWLQEGPAASLSFLVATRAHAG
AYSCQAQDAQGTRSSRPAALQVLYAPQDAVLSSFRDSRARSMAVIQCTVDSEPPAELALS
HDGKVLATSSGVHSLASGTGHVQVARNALRLQVQDVPAGDDTYVCTAQNLLGSISTIGRL
QVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTH
VARAQAGMYHCLAELPTGAAASAPVMLRVLYPPKTPTMMVFVEPEGGLRGILDCRVDSEP
LASLTLHLGSRLVASSQPQGAPAEPHIHVLASPNALRVDIEALRPSDQGEYICSASNVLG
SASTSTYFGVRALHRLHQFQQLLWVLGLLVGLLLLLLGLGACYTWRRRRVCKQSMGENSV
EMAFQKETTQLIDPDAATCETSTCAPPLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A7LCJ3	0.331	0.327	0.000	1730	0.775	0.765	A7LCJ3.pdb.gz	SN_PIG Sialoadhesin OS=Sus scrofa OX=9823 GN=SIGLEC1 PE=1 SV=1
2	AFDB:Q62230	0.330	0.332	0.000	1695	0.724	0.730	Q62230.pdb.gz	SN_MOUSE Sialoadhesin OS=Mus musculus OX=10090 GN=Siglec1 PE=1 SV=2
3	AFDB:O75147	0.087	0.081	1.984E-52	1896	0.190	0.171	O75147.pdb.gz	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
4	AFDB:A0A2R8QL08	0.099	0.087	3.540E-51	2036	0.156	0.131	A0A2R8QL08.pdb.gz
5	AFDB:Q9VS29	0.096	0.084	3.176E-49	2074	0.167	0.137	Q9VS29.pdb.gz	DSCL_DROME Cell adhesion molecule Dscam2 OS=Drosophila melanogaster OX=7227 GN=Dscam2 PE=2 SV=3
6	AFDB:A0A0B4K6Z6	0.097	0.085	2.818E-48	2037	0.150	0.126	A0A0B4K6Z6.pdb.gz	A0A0B4K6Z6_DROME Down syndrome cell adhesion molecule 1, isoform BQ OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1
7	AFDB:Q4VA61	0.102	0.090	5.919E-48	2053	0.151	0.126	Q4VA61.pdb.gz	DSCL1_MOUSE Cell adhesion molecule DSCAML1 OS=Mus musculus OX=10090 GN=Dscaml1 PE=1 SV=2
8	AFDB:Q7KSE9	0.109	0.092	2.882E-46	2087	0.153	0.125	Q7KSE9.pdb.gz	Q7KSE9_DROME Down syndrome cell adhesion molecule 3, isoform E OS=Drosophila melanogaster OX=7227 GN=Dscam3 PE=4 SV=2
9	AFDB:Q8AV57	0.090	0.075	4.872E-42	2177	0.172	0.135	Q8AV57.pdb.gz	SDK2_CHICK Protein sidekick-2 OS=Gallus gallus OX=9031 GN=SDK2 PE=1 SV=2
10	AFDB:O97394	0.098	0.080	7.218E-42	2224	0.156	0.120	O97394.pdb.gz	SDK_DROME Protein sidekick OS=Drosophila melanogaster OX=7227 GN=sdk PE=1 SV=2
11	PDB:5oj2B	0.135	0.254	2.181E-22	692	0.085	0.210	5oj2B.pdb.gz
12	PDB:1e07A	0.078	0.171	2.627E-21	642	0.071	0.188	1e07A.pdb.gz
13	PDB:5a42A	0.085	0.089	5.903E-15	1597	0.081	0.087	5a42A.pdb.gz
14	PDB:7sqcO0	0.077	0.105	1.162E-12	1140	0.066	0.098	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:7q1yA	0.070	0.082	2.694E-11	1374	0.068	0.084	7q1yA.pdb.gz
16	PDB:4lnvA	0.084	0.106	5.416E-11	1276	0.050	0.067	4lnvA.pdb.gz
17	PDB:4ziqA	0.115	0.128	8.023E-11	1450	0.072	0.085	4ziqA.pdb.gz
18	PDB:7q5zA	0.075	0.089	9.146E-11	1344	0.055	0.070	7q5zA.pdb.gz
19	PDB:7vonA	0.097	0.111	9.554E-11	1399	0.060	0.074	7vonA.pdb.gz
20	PDB:1hzhH	0.081	0.205	1.138E-10	457	0.043	0.162	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7LCJ3	0.0	2557	1730	0.768	0.759	SN_PIG Sialoadhesin OS=Sus scrofa OX=9823 GN=SIGLEC1 PE=1 SV=1
2	J9S2W1	0.0	2592	1730	0.776	0.766	J9S2W1_PIG Sialoadhesin OS=Sus scrofa OX=9823 PE=2 SV=1
3	J9T303	0.0	2590	1730	0.775	0.766	J9T303_PIG Sialoadhesin OS=Sus scrofa OX=9823 PE=2 SV=1
4	Q62230	0.0	2466	1695	0.726	0.732	SN_MOUSE Sialoadhesin OS=Mus musculus OX=10090 GN=Siglec1 PE=1 SV=2
5	Q7TN00	3.28e-50	199	3410	0.204	0.102	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2
6	A2ASS6	1.53e-47	191	35213	0.200	0.010	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
7	A0A8I5ZUN3	3.50e-46	186	35375	0.200	0.010	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
8	E7F3V2	6.17e-46	185	4212	0.213	0.086	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
9	A2AJ76	1.98e-45	184	5100	0.216	0.072	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
10	P20273	3.91e-44	176	847	0.100	0.202	CD22_HUMAN B-cell receptor CD22 OS=Homo sapiens OX=9606 GN=CD22 PE=1 SV=2
11	Q8WZ42	1.44e-43	178	34350	0.199	0.010	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
12	Q8NDA2	3.33e-42	173	5059	0.205	0.069	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
13	G5EDG4	3.23e-41	170	3962	0.198	0.086	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
14	P98160	5.44e-41	169	4391	0.232	0.090	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
15	D3YXG0	5.10e-39	163	5634	0.222	0.067	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
16	Q96RW7	2.13e-38	160	5635	0.207	0.063	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
17	A0A8I6A2S5	4.12e-38	160	4402	0.246	0.095	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
18	A0A8I6ASH2	8.20e-38	159	4387	0.246	0.096	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
19	G5ED27	1.52e-37	158	5175	0.197	0.065	G5ED27_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
20	G5EG33	1.56e-37	158	5198	0.197	0.065	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06832 BiPBP_C	1.2e-08	46.3	Penicillin-Binding Protein C-terminus Family
2	PF07654 C1-set	3e-17	74.1	Immunoglobulin C1-set domain
3	PF08205 C2-set_2	3.7e-24	95.9	CD80-like C2-set immunoglobulin domain
4	PF07679 I-set	5.6e-80	274.8	Immunoglobulin I-set domain
5	PF00047 ig	8.3e-72	248.8	Immunoglobulin domain
6	PF13895 Ig_2	2.8e-114	384.9	Immunoglobulin domain
7	PF13927 Ig_3	1.3e-116	392.7	Immunoglobulin domain
8	PF16680 Ig_4	2.6e-19	80.9	T-cell surface glycoprotein CD3 delta chain
9	PF16681 Ig_5	3.8e-17	73.8	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
10	PF18452 Ig_6	0.0012	30.1	Immunoglobulin domain
11	PF16706 Izumo-Ig	6.4e-13	59.8	Izumo-like Immunoglobulin domain
12	PF11465 Receptor_2B4	3.1	19.4	Natural killer cell receptor 2B4
13	PF07686 V-set	3.6e-58	205.8	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341141

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353238	0.980	Leukosialin
2	9606.ENSP00000262629	0.952	TYRO protein tyrosine kinase-binding protein
3	9606.ENSP00000484824	0.929	Mucin-1
4	9606.ENSP00000383931	0.915	Platelet glycoprotein V
5	9606.ENSP00000352071	0.894	Scavenger receptor cysteine-rich type 1 protein M130
6	9606.ENSP00000374125	0.853	Sialic acid-binding Ig-like lectin 15
7	9606.ENSP00000266041	0.845	Inter-alpha-trypsin inhibitor heavy chain H4
8	9606.ENSP00000441691	0.771	Integrin alpha-M
9	9606.ENSP00000454623	0.752	Integrin alpha-X
10	9606.ENSP00000455897	0.744	Macrophage mannose receptor 1
11	9606.ENSP00000363089	0.741	Toll-like receptor 4
12	9606.ENSP00000011653	0.724	T-cell surface glycoprotein CD4
13	9606.ENSP00000356946	0.712	Low affinity immunoglobulin gamma Fc region receptor III-A
14	9606.ENSP00000351475	0.695	PAS domain-containing serine/threonine-protein kinase
15	9606.ENSP00000311502	0.684	Protein HEG homolog 1
16	9606.ENSP00000315477	0.681	CD209 antigen
17	9606.ENSP00000358165	0.673	High affinity immunoglobulin gamma Fc receptor I
18	9606.ENSP00000419945	0.670	Syncytin-1
19	9606.ENSP00000332049	0.668	T-lymphocyte activation antigen CD86
20	9606.ENSP00000411355	0.666	Receptor-type tyrosine-protein phosphatase C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0046790	0.999	virion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0044419	0.989	biological process involved in interspecies interaction between organisms
GO:0016192	0.988	vesicle-mediated transport
GO:0046718	0.983	viral entry into host cell
GO:0006897	0.972	endocytosis
GO:0072583	0.948	clathrin-dependent endocytosis
GO:0050764	0.946	regulation of phagocytosis
GO:0046794	0.931	transport of virus
GO:0048519	0.911	negative regulation of biological process
GO:0009987	0.856	cellular process
GO:0048518	0.795	positive regulation of biological process
GO:0051051	0.768	negative regulation of transport
GO:0050765	0.747	negative regulation of phagocytosis
GO:0050896	0.676	response to stimulus
GO:0048583	0.548	regulation of response to stimulus
GO:0048522	0.473	positive regulation of cellular process
GO:0023051	0.351	regulation of signaling
GO:0010646	0.351	regulation of cell communication
GO:0048584	0.337	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005886	1.000	plasma membrane
GO:0031410	1.000	cytoplasmic vesicle
GO:0005768	0.927	endosome
GO:0005769	0.875	early endosome
GO:0005770	0.864	late endosome
GO:0030139	0.809	endocytic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]