StarFunc result for job id Q9C000

User Input

>input (1473 residues)
MAGGAWGRLACYLEFLKKEELKEFQLLLANKAHSRSSSGETPAQPEKTSGMEVASYLVAQ
YGEQRAWDLALHTWEQMGLRSLCAQAQEGAGHSPSFPYSPSEPHLGSPSQPTSTAVLMPW
IHELPAGCTQGSERRVLRQLPDTSGRRWREISASLLYQALPSSPDHESPSQESPNAPTST
AVLGSWGSPPQPSLAPREQEAPGTQWPLDETSGIYYTEIREREREKSEKGRPPWAAVVGT
PPQAHTSLQPHHHPWEPSVRESLCSTWPWKNEDFNQKFTQLLLLQRPHPRSQDPLVKRSW
PDYVEENRGHLIEIRDLFGPGLDTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDR
FQHVFYFSCRELAQSKVVSLAELIGKDGTATPAPIRQILSRPERLLFILDGVDEPGWVLQ
EPSSELCLHWSQPQPADALLGSLLGKTILPEASFLITARTTALQNLIPSLEQARWVEVLG
FSESSRKEYFYRYFTDERQAIRAFRLVKSNKELWALCLVPWVSWLACTCLMQQMKRKEKL
TLTSKTTTTLCLHYLAQALQAQPLGPQLRDLCSLAAEGIWQKKTLFSPDDLRKHGLDGAI
ISTFLKMGILQEHPIPLSYSFIHLCFQEFFAAMSYVLEDEKGRGKHSNCIIDLEKTLEAY
GIHGLFGASTTRFLLGLLSDEGEREMENIFHCRLSQGRNLMQWVPSLQLLLQPHSLESLH
CLYETRNKTFLTQVMAHFEEMGMCVETDMELLVCTFCIKFSRHVKKLQLIEGRQHRSTWS
PTMVVLFRWVPVTDAYWQILFSVLKVTRNLKELDLSGNSLSHSAVKSLCKTLRRPRCLLE
TLRLAGCGLTAEDCKDLAFGLRANQTLTELDLSFNVLTDAGAKHLCQRLRQPSCKLQRLQ
LVSCGLTSDCCQDLASVLSASPSLKELDLQQNNLDDVGVRLLCEGLRHPACKLIRLGLDQ
TTLSDEMRQELRALEQEKPQLLIFSRRKPSVMTPTEGLDTGEMSNSTSSLKRQRLGSERA
ASHVAQANLKLLDVSKIFPIAEIAEESSPEVVPVELLCVPSPASQGDLHTKPLGTDDDFW
GPTGPVATEVVDKEKNLYRVHFPVAGSYRWPNTGLCFVMREAVTVEIEFCVWDQFLGEIN
PQHSWMVAGPLLDIKAEPGAVEAVHLPHFVALQGGHVDTSLFQMAHFKEEGMLLEKPARV
ELHHIVLENPSFSPLGVLLKMIHNALRFIPVTSVVLLYHRVHPEEVTFHLYLIPSDCSIR
KAIDDLEMKFQFVRIHKPPPLTPLYMGCRYTVSGSGSGMLEILPKELELCYRSPGEDQLF
SEFYVGHLGSGIRLQVKDKKDETLVWEALVKPGDLMPATTLIPPARIAVPSPLDAPQLLH
FVDQYREQLIARVTSVEVVLDKLHGQVLSQEQYERVLAENTRPSQMRKLFSLSQSWDRKC
KDGLYQALKETHPHLIMELWEKGSKKGLLPLSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2LKW6	0.377	0.445	0.000	1233	0.428	0.511	Q2LKW6.pdb.gz	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
2	AFDB:Q9C000	1.000	1.000	0.000	1473	1.000	1.000	Q9C000.pdb.gz	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
3	AFDB:Q96P20	0.222	0.293	1.837E-52	1036	0.209	0.297	Q96P20.pdb.gz	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
4	AFDB:P59046	0.380	0.510	1.064E-51	1061	0.227	0.315	P59046.pdb.gz	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
5	AFDB:D4A523	0.297	0.411	1.827E-51	1035	0.210	0.300	D4A523.pdb.gz	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
6	AFDB:E9Q5R7	0.427	0.589	9.243E-51	1054	0.212	0.297	E9Q5R7.pdb.gz	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
7	AFDB:Q86W24	0.286	0.377	4.063E-49	1093	0.210	0.284	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
8	AFDB:Q96MN2	0.278	0.398	3.949E-44	994	0.192	0.285	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
9	AFDB:F1MT67	0.320	0.415	2.393E-43	1098	0.185	0.248	F1MT67.pdb.gz	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
10	AFDB:Q3UWL9	0.271	0.405	1.211E-42	944	0.147	0.230	Q3UWL9.pdb.gz	Q3UWL9_MOUSE NACHT, LRR and PYD domains-containing protein 4F OS=Mus musculus OX=10090 GN=Nlrp4g PE=2 SV=1
11	PDB:7pzcA	0.416	0.598	1.781E-39	1010	0.219	0.320	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
12	PDB:7lfhA	0.373	0.652	7.033E-35	806	0.191	0.349	7lfhA.pdb.gz
13	PDB:7crwA	0.186	0.949	8.759E-34	279	0.129	0.681	7crwA.pdb.gz
14	PDB:6npyA	0.317	0.520	8.906E-29	798	0.175	0.323	6npyA.pdb.gz	Structural mechanism for NEK7-licensed activation of NLRP3 inflammasome.
15	PDB:4kxfP	0.236	0.384	2.003E-20	866	0.093	0.158	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
16	PDB:7jkqB	0.168	0.848	1.872E-16	272	0.056	0.305	7jkqB.pdb.gz
17	PDB:6x6cF	0.092	0.917	1.420E-15	138	0.094	1.000	6x6cF.pdb.gz	DPP9 sequesters the C terminus of NLRP1 to repress inflammasome activation.
18	PDB:6x6cE	0.088	0.888	4.162E-14	134	0.090	0.993	6x6cE.pdb.gz	DPP9 sequesters the C terminus of NLRP1 to repress inflammasome activation.
19	PDB:1a4yA	0.147	0.418	5.214E-14	460	0.064	0.204	1a4yA.pdb.gz
20	PDB:3jblA	0.149	0.220	3.159E-13	909	0.095	0.154	3jblA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z198	0.0	1097	1177	0.420	0.525	NL1B2_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 2 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
2	D9I2F9	0.0	1142	1218	0.437	0.528	NL1A1_RAT NACHT, LRR and PYD domains-containing protein 1a allele 1 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
3	D9I2G1	0.0	1143	1218	0.438	0.530	NL1A4_RAT NACHT, LRR and PYD domains-containing protein 1a allele 4 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
4	D9I2G3	0.0	1142	1218	0.437	0.528	NL1A2_RAT NACHT, LRR and PYD domains-containing protein 1 allele 2 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=1 SV=1
5	D9I2G4	0.0	1146	1218	0.439	0.531	NL1A5_RAT NACHT, LRR and PYD domains-containing protein 1a allele 5 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
6	D9I2H0	0.0	1143	1218	0.438	0.530	NL1A3_RAT NACHT, LRR and PYD domains-containing protein 1a allele 3 OS=Rattus norvegicus OX=10116 GN=Nlrp1a PE=2 SV=1
7	Q0GKD5	0.0	1065	1196	0.410	0.505	NL1B5_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 5 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
8	Q2LKU9	0.0	651	1182	0.238	0.297	NLR1A_MOUSE NACHT, LRR and PYD domains-containing protein 1a OS=Mus musculus OX=10090 GN=Nlrp1a PE=1 SV=1
9	Q2LKV2	0.0	733	906	0.293	0.476	NL1B4_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 4 OS=Mus musculus OX=10090 GN=Nlrp1b PE=2 SV=1
10	Q2LKV5	0.0	1071	1172	0.408	0.513	NL1B3_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 3 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
11	Q2LKW6	0.0	1125	1233	0.424	0.507	NL1B1_MOUSE NACHT, LRR and PYD domains-containing protein 1b allele 1 OS=Mus musculus OX=10090 GN=Nlrp1b PE=1 SV=1
12	Q9C000	0.0	3020	1473	1.000	1.000	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
13	P59046	5.68e-147	478	1061	0.211	0.293	NAL12_HUMAN NACHT, LRR and PYD domains-containing protein 12 OS=Homo sapiens OX=9606 GN=NLRP12 PE=1 SV=2
14	Q96P20	1.70e-143	468	1036	0.192	0.273	NLRP3_HUMAN NACHT, LRR and PYD domains-containing protein 3 OS=Homo sapiens OX=9606 GN=NLRP3 PE=1 SV=3
15	Q8R4B8	6.90e-141	461	1033	0.198	0.282	NLRP3_MOUSE NACHT, LRR and PYD domains-containing protein 3 OS=Mus musculus OX=10090 GN=Nlrp3 PE=1 SV=1
16	D4A523	2.88e-135	446	1035	0.193	0.275	NLRP3_RAT NACHT, LRR and PYD domains-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Nlrp3 PE=3 SV=2
17	Q86W24	8.92e-128	427	1093	0.176	0.237	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
18	E9Q5R7	1.37e-126	422	1054	0.193	0.270	NAL12_MOUSE NACHT, LRR and PYD domains-containing protein 12 OS=Mus musculus OX=10090 GN=Nlrp12 PE=1 SV=1
19	Q96MN2	1.31e-94	331	994	0.159	0.235	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
20	Q7RTR0	8.65e-94	328	991	0.164	0.243	NLRP9_HUMAN NACHT, LRR and PYD domains-containing protein 9 OS=Homo sapiens OX=9606 GN=NLRP9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	4.1e+02	12.4	AAA domain
2	PF13191 AAA_16	0.0011	30.8	AAA ATPase domain
3	PF13401 AAA_22	1.6e+02	14.0	AAA domain
4	PF13604 AAA_30	31	15.7	AAA domain
5	PF07728 AAA_5	2.6e+02	13.0	AAA domain (dynein-related subfamily)
6	PF00619 CARD	3.5e-16	70.3	Caspase recruitment domain
7	PF13553 FIIND	2.3e-103	356.6	Function to find
8	PF04523 Herpes_U30	4.2e+02	10.2	Herpes virus tegument protein U30
9	PF00560 LRR_1	4.3	19.0	Leucine Rich Repeat
10	PF12799 LRR_4	5.6	18.8	Leucine Rich repeats (2 copies)
11	PF13516 LRR_6	1.7e-11	54.2	Leucine Rich repeat
12	PF13855 LRR_8	2.8	19.1	Leucine rich repeat
13	PF05729 NACHT	3.4e-43	158.9	NACHT domain
14	PF00931 NB-ARC	18	16.0	NB-ARC domain
15	PF17776 NLRC4_HD2	5.7e-15	67.5	NLRC4 helical domain HD2
16	PF17779 NOD2_WH	1.2e-09	49.6	NOD2 winged helix domain
17	PF02758 PYRIN	3.1e-13	61.0	PAAD/DAPIN/Pyrin domain
18	PF06414 Zeta_toxin	6.6e+02	11.1	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478516

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433138	0.999	Caspase-1
2	9606.ENSP00000376849	0.998	Caspase-5
3	9606.ENSP00000302564	0.996	Bcl-2-like protein 1
4	9606.ENSP00000385090	0.996	NLR family CARD domain-containing protein 4
5	9606.ENSP00000357112	0.990	Interferon-inducible protein AIM2
6	9606.ENSP00000247470	0.938	Apoptosis-associated speck-like protein containing a CARD
7	9606.ENSP00000337383	0.925	NACHT, LRR and PYD domains-containing protein 3
8	9606.ENSP00000225296	0.923	Putative ATP-dependent RNA helicase DHX33
9	9606.ENSP00000219596	0.918	Pyrin
10	9606.ENSP00000331857	0.917	NACHT, LRR and PYD domains-containing protein 9
11	9606.ENSP00000300589	0.916	Nucleotide-binding oligomerization domain-containing protein 2
12	9606.ENSP00000375767	0.912	Caspase recruitment domain-containing protein 8
13	9606.ENSP00000433209	0.912	Gasdermin-D
14	9606.ENSP00000381185	0.896	Apoptosis regulator Bcl-2
15	9606.ENSP00000280357	0.880	Interleukin-18
16	9606.ENSP00000388566	0.782	Caspase-4
17	9606.ENSP00000312664	0.778	Caspase-2
18	9606.ENSP00000262960	0.769	Dipeptidyl peptidase 9
19	9606.ENSP00000448165	0.769	Apoptotic protease-activating factor 1
20	9606.ENSP00000263341	0.761	Interleukin-1 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0019904	0.991	protein domain specific binding
GO:0003824	0.979	catalytic activity
GO:0019899	0.979	enzyme binding
GO:1901363	0.976	heterocyclic compound binding
GO:0097367	0.976	carbohydrate derivative binding
GO:0097159	0.976	organic cyclic compound binding
GO:0140677	0.973	molecular function activator activity
GO:0008233	0.972	peptidase activity
GO:0016818	0.966	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0016887	0.963	ATP hydrolysis activity
GO:0030234	0.949	enzyme regulator activity
GO:0043621	0.942	protein self-association
GO:0003676	0.901	nucleic acid binding
GO:0003725	0.843	double-stranded RNA binding
GO:0003677	0.830	DNA binding
GO:0043167	0.829	ion binding
GO:0016504	0.824	peptidase activator activity
GO:0004175	0.823	endopeptidase activity
GO:0061133	0.796	endopeptidase activator activity
GO:0043168	0.785	anion binding
GO:0036094	0.784	small molecule binding
GO:0003690	0.773	double-stranded DNA binding
GO:0000166	0.759	nucleotide binding
GO:0032559	0.751	adenyl ribonucleotide binding
GO:0035639	0.742	purine ribonucleoside triphosphate binding
GO:0140608	0.557	cysteine-type endopeptidase activator activity
GO:0005524	0.508	ATP binding
GO:0042802	0.358	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.984	positive regulation of biological process
GO:0009987	0.975	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0050896	0.970	response to stimulus
GO:0019222	0.968	regulation of metabolic process
GO:0080134	0.966	regulation of response to stress
GO:0008219	0.964	cell death
GO:0060255	0.948	regulation of macromolecule metabolic process
GO:0012501	0.946	programmed cell death
GO:0031347	0.946	regulation of defense response
GO:2000116	0.909	regulation of cysteine-type endopeptidase activity
GO:0044419	0.877	biological process involved in interspecies interaction between organisms
GO:0032732	0.876	positive regulation of interleukin-1 production
GO:0007154	0.856	cell communication
GO:0023052	0.851	signaling
GO:0032651	0.847	regulation of interleukin-1 beta production
GO:0007165	0.843	signal transduction
GO:0010950	0.843	positive regulation of endopeptidase activity
GO:0042221	0.841	response to chemical
GO:0048584	0.841	positive regulation of response to stimulus
GO:0048522	0.839	positive regulation of cellular process
GO:0019538	0.828	protein metabolic process
GO:0009607	0.821	response to biotic stimulus
GO:0048519	0.815	negative regulation of biological process
GO:0043281	0.796	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0032101	0.783	regulation of response to external stimulus
GO:0002376	0.770	immune system process
GO:0010033	0.769	response to organic substance
GO:2001056	0.767	positive regulation of cysteine-type endopeptidase activity
GO:0032103	0.752	positive regulation of response to external stimulus
GO:0032731	0.746	positive regulation of interleukin-1 beta production
GO:0006950	0.736	response to stress
GO:0031349	0.727	positive regulation of defense response
GO:0048585	0.725	negative regulation of response to stimulus
GO:0009605	0.717	response to external stimulus
GO:0006955	0.686	immune response
GO:0031323	0.670	regulation of cellular metabolic process
GO:0051707	0.664	response to other organism
GO:0019219	0.635	regulation of nucleobase-containing compound metabolic process
GO:0006952	0.628	defense response
GO:0098542	0.614	defense response to other organism
GO:0006915	0.602	apoptotic process
GO:0009966	0.555	regulation of signal transduction
GO:0050727	0.546	regulation of inflammatory response
GO:0009615	0.544	response to virus
GO:0071840	0.534	cellular component organization or biogenesis
GO:0035556	0.532	intracellular signal transduction
GO:0043280	0.514	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0045087	0.511	innate immune response
GO:0016043	0.500	cellular component organization
GO:0009889	0.495	regulation of biosynthetic process
GO:0031326	0.481	regulation of cellular biosynthetic process
GO:0010556	0.466	regulation of macromolecule biosynthetic process
GO:0070887	0.434	cellular response to chemical stimulus
GO:0010941	0.429	regulation of cell death
GO:0051090	0.429	regulation of DNA-binding transcription factor activity
GO:0043067	0.394	regulation of programmed cell death
GO:0050729	0.361	positive regulation of inflammatory response
GO:0051607	0.357	defense response to virus
GO:0009892	0.347	negative regulation of metabolic process
GO:0048523	0.339	negative regulation of cellular process
GO:0071310	0.335	cellular response to organic substance
GO:0065003	0.300	protein-containing complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0005654	0.997	nucleoplasm
GO:0061702	0.923	inflammasome complex
GO:0016020	0.760	membrane
GO:0012505	0.685	endomembrane system
GO:0072558	0.469	NLRP1 inflammasome complex
GO:0043228	0.306	non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.972	Acting on peptide bonds (peptidases).
EC:3.6.1.-	0.966	In phosphorus-containing anhydrides.
RHEA:13065	0.963	ATP + H2O = ADP + H(+) + phosphate

[back to server]