StarFunc result for job id Q9C004

User Input

>input (299 residues)
MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLAL
TTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPV
ADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCW
VCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGA
LSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9WTP2	0.472	0.470	2.222E-40	300	0.930	0.927	Q9WTP2.pdb.gz	SPY4_MOUSE Protein sprouty homolog 4 OS=Mus musculus OX=10090 GN=Spry4 PE=1 SV=1
2	AFDB:O43610	0.437	0.453	3.017E-19	288	0.398	0.413	O43610.pdb.gz	SPY3_HUMAN Protein sprouty homolog 3 OS=Homo sapiens OX=9606 GN=SPRY3 PE=1 SV=2
3	AFDB:A0A0B4LEU5	0.112	0.046	2.612	979	0.147	0.045	A0A0B4LEU5.pdb.gz	A0A0B4LEU5_DROME ADD domain-containing protein 1, isoform E OS=Drosophila melanogaster OX=7227 GN=ADD1 PE=1 SV=1
4	AFDB:Q9LE42	0.135	0.037	2.612	1670	0.120	0.022	Q9LE42.pdb.gz	HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis thaliana OX=3702 GN=HAC5 PE=2 SV=1
5	AFDB:Q9UK53	0.081	0.062	2.776	422	0.147	0.104	Q9UK53.pdb.gz	ING1_HUMAN Inhibitor of growth protein 1 OS=Homo sapiens OX=9606 GN=ING1 PE=1 SV=2
6	AFDB:Q9UKI9	0.079	0.068	3.333	436	0.151	0.103	Q9UKI9.pdb.gz	PO2F3_HUMAN POU domain, class 2, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU2F3 PE=1 SV=3
7	AFDB:O42967	0.110	0.066	3.542	603	0.174	0.086	O42967.pdb.gz	YB92_SCHPO Uncharacterized ubiquitin-like protein C1E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1E8.02 PE=1 SV=1
8	AFDB:P54277	0.097	0.046	3.765	932	0.130	0.042	P54277.pdb.gz	PMS1_HUMAN PMS1 protein homolog 1 OS=Homo sapiens OX=9606 GN=PMS1 PE=1 SV=1
9	AFDB:P17542	0.101	0.094	4.001	331	0.164	0.148	P17542.pdb.gz	TAL1_HUMAN T-cell acute lymphocytic leukemia protein 1 OS=Homo sapiens OX=9606 GN=TAL1 PE=1 SV=2
10	AFDB:Q84LH8	0.097	0.075	4.803	444	0.137	0.092	Q84LH8.pdb.gz	PIF5_ARATH Transcription factor PIF5 OS=Arabidopsis thaliana OX=3702 GN=PIF5 PE=1 SV=1
11	PDB:7acoB	0.089	0.139	4.841	180	0.033	0.056	7acoB.pdb.gz
12	PDB:1h7cA	0.113	0.241	6.564	103	0.017	0.049	1h7cA.pdb.gz
13	PDB:6ta5D	0.112	0.100	7.880	345	0.040	0.035	6ta5D.pdb.gz
14	PDB:7mfdA	0.098	0.077	7.880	410	0.054	0.039	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
15	PDB:6gg1A	0.107	0.177	8.375	145	0.033	0.069	6gg1A.pdb.gz
16	PDB:7ungB0	0.083	0.111	8.375	193	0.040	0.062	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
17	PDB:8dwcR	0.087	0.101	8.375	250	0.050	0.060	8dwcR.pdb.gz	Ligand recognition and allosteric modulation of the human MRGPRX1 receptor.
18	PDB:2f1kA	0.095	0.100	9.459	279	0.033	0.036	2f1kA.pdb.gz	Biochemical Characterization and Crystal Structure of Synechocystis Arogenate Dehydrogenase Provide Insights into Catalytic Reaction
19	PDB:6wlwT	0.116	0.323	9.459	85	0.043	0.153	6wlwT.pdb.gz	Structures of a Complete Human V-ATPase Reveal Mechanisms of Its Assembly.
20	PDB:7k041	0.089	0.064	9.459	487	0.040	0.025	7k041.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C004	0.0	609	299	1.000	1.000	SPY4_HUMAN Protein sprouty homolog 4 OS=Homo sapiens OX=9606 GN=SPRY4 PE=1 SV=2
2	Q9WTP2	0.0	548	300	0.930	0.927	SPY4_MOUSE Protein sprouty homolog 4 OS=Mus musculus OX=10090 GN=Spry4 PE=1 SV=1
3	Q90XH4	4.32e-111	325	310	0.622	0.600	Q90XH4_DANRE Sprouty4 OS=Danio rerio OX=7955 GN=sprouty4 PE=2 SV=1
4	O43609	2.70e-64	206	319	0.445	0.417	SPY1_HUMAN Protein sprouty homolog 1 OS=Homo sapiens OX=9606 GN=SPRY1 PE=1 SV=2
5	O43597	1.09e-62	202	315	0.398	0.378	SPY2_HUMAN Protein sprouty homolog 2 OS=Homo sapiens OX=9606 GN=SPRY2 PE=1 SV=1
6	O43610	6.99e-62	199	288	0.401	0.417	SPY3_HUMAN Protein sprouty homolog 3 OS=Homo sapiens OX=9606 GN=SPRY3 PE=1 SV=2
7	Q7Z783	1.47e-61	201	353	0.341	0.289	Q7Z783_HUMAN SPRY2 protein OS=Homo sapiens OX=9606 PE=1 SV=1
8	Q9QXV8	1.73e-61	199	315	0.411	0.390	SPY2_MOUSE Protein sprouty homolog 2 OS=Mus musculus OX=10090 GN=Spry2 PE=1 SV=1
9	Q3UUD2	6.61e-59	192	288	0.391	0.406	SPRY3_MOUSE Protein sprouty homolog 3 OS=Mus musculus OX=10090 GN=Spry3 PE=1 SV=1
10	F1QU39	7.25e-55	182	301	0.371	0.369	F1QU39_DANRE Protein sprouty homolog 2 isoform X1 OS=Danio rerio OX=7955 GN=wu:fk66h11 PE=4 SV=1
11	Q4VBS7	2.12e-54	181	301	0.371	0.369	Q4VBS7_DANRE Protein sprouty homolog 2 OS=Danio rerio OX=7955 GN=zgc:110440 PE=2 SV=1
12	Q9QXV9	7.76e-53	177	313	0.438	0.419	SPY1_MOUSE Protein sprouty homolog 1 OS=Mus musculus OX=10090 GN=Spry1 PE=1 SV=1
13	B5DFH3	1.70e-52	176	313	0.438	0.419	B5DFH3_RAT Sprouty RTK signaling antagonist 1 OS=Rattus norvegicus OX=10116 GN=Spry1 PE=2 SV=1
14	O44783	2.15e-34	133	589	0.191	0.097	SPY_DROME Protein sprouty OS=Drosophila melanogaster OX=7227 GN=sty PE=1 SV=2
15	D6RHD2	2.99e-20	89.0	209	0.234	0.335	D6RHD2_HUMAN Sprouty RTK signaling antagonist 1 (Fragment) OS=Homo sapiens OX=9606 GN=SPRY1 PE=1 SV=1
16	Q7Z699	2.38e-06	50.8	444	0.087	0.059	SPRE1_HUMAN Sprouty-related, EVH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=2
17	Q924S8	2.38e-06	50.8	444	0.087	0.059	SPRE1_MOUSE Sprouty-related, EVH1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Spred1 PE=1 SV=1
18	A0A0B4KG11	5.19e-06	50.1	519	0.084	0.048	A0A0B4KG11_DROME Sprouty-related protein with EVH-1 domain, isoform C OS=Drosophila melanogaster OX=7227 GN=Spred PE=4 SV=1
19	Q7K0G4	5.47e-06	49.7	426	0.084	0.059	Q7K0G4_DROME SD10629p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
20	F0JAK5	5.79e-06	49.7	404	0.084	0.062	F0JAK5_DROME LD31195p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05210 Sprouty	4.3e-31	119.1	Sprouty protein (Spry)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344967

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264033	0.975	E3 ubiquitin-protein ligase CBL
2	9606.ENSP00000376345	0.954	Growth factor receptor-bound protein 2
3	9606.ENSP00000407586	0.949	GTPase HRas
4	9606.ENSP00000366306	0.944	Protein sprouty homolog 2
5	9606.ENSP00000274376	0.927	Ras GTPase-activating protein 1
6	9606.ENSP00000481675	0.925	Protein sprouty homolog 1
7	9606.ENSP00000302978	0.921	Protein sprouty homolog 3
8	9606.ENSP00000481045	0.921	Dual specificity testis-specific protein kinase 1
9	9606.ENSP00000334928	0.910	Receptor-type tyrosine-protein phosphatase beta
10	9606.ENSP00000251849	0.768	RAF proto-oncogene serine/threonine-protein kinase
11	9606.ENSP00000321835	0.764	ETS translocation variant 4
12	9606.ENSP00000279488	0.753	Dual specificity protein phosphatase 6
13	9606.ENSP00000296318	0.730	Interleukin-17 receptor D
14	9606.ENSP00000321797	0.709	Fibroblast growth factor 8
15	9606.ENSP00000440440	0.705	Activating transcription factor 7-interacting protein 1
16	9606.ENSP00000306894	0.703	ETS translocation variant 5
17	9606.ENSP00000482581	0.700	Twist-related protein 2
18	9606.ENSP00000240100	0.662	Dual specificity protein phosphatase 4
19	9606.ENSP00000393312	0.647	Fibroblast growth factor receptor 1
20	9606.ENSP00000414147	0.640	Spartin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.385	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048523	0.991	negative regulation of cellular process
GO:0009987	0.964	cellular process
GO:0050896	0.920	response to stimulus
GO:0009966	0.906	regulation of signal transduction
GO:0051716	0.862	cellular response to stimulus
GO:0043408	0.856	regulation of MAPK cascade
GO:0009968	0.832	negative regulation of signal transduction
GO:0019222	0.830	regulation of metabolic process
GO:0010810	0.774	regulation of cell-substrate adhesion
GO:1900024	0.752	regulation of substrate adhesion-dependent cell spreading
GO:0060255	0.692	regulation of macromolecule metabolic process
GO:0031323	0.687	regulation of cellular metabolic process
GO:0080090	0.684	regulation of primary metabolic process
GO:0051171	0.684	regulation of nitrogen compound metabolic process
GO:0043409	0.675	negative regulation of MAPK cascade
GO:0001932	0.622	regulation of protein phosphorylation
GO:0048856	0.615	anatomical structure development
GO:0065009	0.535	regulation of molecular function
GO:0032501	0.534	multicellular organismal process
GO:0048518	0.471	positive regulation of biological process
GO:0042221	0.456	response to chemical
GO:0007275	0.446	multicellular organism development
GO:0050790	0.424	regulation of catalytic activity
GO:0010605	0.366	negative regulation of macromolecule metabolic process
GO:0051172	0.363	negative regulation of nitrogen compound metabolic process
GO:0048522	0.344	positive regulation of cellular process
GO:0051338	0.343	regulation of transferase activity
GO:0031324	0.331	negative regulation of cellular metabolic process
GO:0023052	0.304	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.918	cytosol
GO:0043226	0.878	organelle
GO:0043229	0.857	intracellular organelle
GO:0043227	0.704	membrane-bounded organelle
GO:0030054	0.681	cell junction
GO:0043231	0.680	intracellular membrane-bounded organelle
GO:0030055	0.626	cell-substrate junction
GO:0005925	0.389	focal adhesion
GO:0016020	0.378	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]