StarFunc result for job id Q9C010

User Input

>input (78 residues)
MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKE
KDEKTTQDQLEKPQNEEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:Q9C010	1.000	1.000	2.055E-11	78	1.000	1.000	Q9C010.pdb.gz	IPKB_HUMAN cAMP-dependent protein kinase inhibitor beta OS=Homo sapiens OX=9606 GN=PKIB PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C010	9.43e-51	155	78	1.000	1.000	IPKB_HUMAN cAMP-dependent protein kinase inhibitor beta OS=Homo sapiens OX=9606 GN=PKIB PE=1 SV=1
2	Q04758	2.27e-33	112	92	0.744	0.630	IPKB_MOUSE cAMP-dependent protein kinase inhibitor beta OS=Mus musculus OX=10090 GN=Pkib PE=3 SV=1
3	P61925	2.67e-10	53.1	76	0.359	0.368	IPKA_HUMAN cAMP-dependent protein kinase inhibitor alpha OS=Homo sapiens OX=9606 GN=PKIA PE=1 SV=2
4	P61926	2.67e-10	53.1	76	0.359	0.368	IPKA_RABIT cAMP-dependent protein kinase inhibitor alpha OS=Oryctolagus cuniculus OX=9986 GN=PKIA PE=1 SV=2
5	P63248	5.30e-10	52.4	76	0.359	0.368	IPKA_MOUSE cAMP-dependent protein kinase inhibitor alpha OS=Mus musculus OX=10090 GN=Pkia PE=1 SV=2
6	P63249	5.30e-10	52.4	76	0.359	0.368	IPKA_RAT cAMP-dependent protein kinase inhibitor alpha OS=Rattus norvegicus OX=10116 GN=Pkia PE=1 SV=2
7	F7F4X2	3.46e-06	44.3	200	0.231	0.090	F7F4X2_RAT cAMP-dependent protein kinase inhibitor gamma OS=Rattus norvegicus OX=10116 GN=Pkig PE=1 SV=1
8	O70139	1.93e-04	38.1	76	0.205	0.211	IPKG_MOUSE cAMP-dependent protein kinase inhibitor gamma OS=Mus musculus OX=10090 GN=Pkig PE=1 SV=1
9	Q549H9	2.35e-04	37.7	76	0.205	0.211	Q549H9_HUMAN cAMP-dependent protein kinase inhibitor OS=Homo sapiens OX=9606 GN=PKIG PE=1 SV=1
10	Q9Y2B9	2.35e-04	37.7	76	0.205	0.211	IPKG_HUMAN cAMP-dependent protein kinase inhibitor gamma OS=Homo sapiens OX=9606 GN=PKIG PE=1 SV=1
11	Q580H7	3.1	28.1	407	0.154	0.029	Q580H7_TRYB2 EamA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O9.90 PE=4 SV=1
12	P10731	4.6	27.7	972	0.205	0.016	AMD_BOVIN Peptidyl-glycine alpha-amidating monooxygenase OS=Bos taurus OX=9913 GN=PAM PE=1 SV=2
13	P19021	5.3	27.3	973	0.205	0.016	AMD_HUMAN Peptidyl-glycine alpha-amidating monooxygenase OS=Homo sapiens OX=9606 GN=PAM PE=1 SV=2
14	Q69T21	7.5	26.9	451	0.231	0.040	TGAL8_ORYSJ Transcription factor TGAL8 OS=Oryza sativa subsp. japonica OX=39947 GN=TGAL8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02827 PKI	4.4e-28	108.7	cAMP-dependent protein kinase inhibitor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388137	0.646	Metallophosphoesterase domain-containing protein 1
2	9606.ENSP00000264313	0.634	SLAIN motif-containing protein 2
3	9606.ENSP00000360485	0.617	A-kinase anchor protein 14
4	9606.ENSP00000369689	0.608	Calmodulin-like protein 5
5	9606.ENSP00000361980	0.563	cAMP-dependent protein kinase inhibitor gamma
6	9606.ENSP00000299290	0.504	Protein TBATA
7	9606.ENSP00000370896	0.504	Protein GREB1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030291	0.917	protein serine/threonine kinase inhibitor activity
GO:0004862	0.913	cAMP-dependent protein kinase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051338	0.989	regulation of transferase activity
GO:0080090	0.988	regulation of primary metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0031323	0.988	regulation of cellular metabolic process
GO:0048522	0.957	positive regulation of cellular process
GO:0033043	0.946	regulation of organelle organization
GO:0010638	0.887	positive regulation of organelle organization
GO:0033044	0.819	regulation of chromosome organization
GO:2000278	0.815	regulation of DNA biosynthetic process
GO:2001252	0.796	positive regulation of chromosome organization
GO:0051054	0.785	positive regulation of DNA metabolic process
GO:0032204	0.688	regulation of telomere maintenance
GO:1904356	0.663	regulation of telomere maintenance via telomere lengthening
GO:0032210	0.634	regulation of telomere maintenance via telomerase
GO:0051972	0.509	regulation of telomerase activity
GO:2000573	0.452	positive regulation of DNA biosynthetic process
GO:0006469	0.415	negative regulation of protein kinase activity
GO:0009987	0.409	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]