StarFunc result for job id Q9C026

User Input

>input (710 residues)
MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDY
DYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPV
PRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATV
MCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMY
CVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRN
MVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKL
RQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNS
PLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELD
DGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAF
DPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVAR
MDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTF
FINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C7M3	0.532	0.470	0.000	817	0.956	0.831	Q8C7M3.pdb.gz	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
2	AFDB:Q91ZY8	0.545	0.545	0.000	710	0.977	0.977	Q91ZY8.pdb.gz	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
3	AFDB:Q505D9	0.400	0.374	2.350E-97	768	0.680	0.629	Q505D9.pdb.gz	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
4	AFDB:M9MRI4	0.429	0.413	1.695E-77	740	0.431	0.414	M9MRI4.pdb.gz	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
5	AFDB:Q9UAQ3	0.386	0.360	6.721E-70	765	0.396	0.367	Q9UAQ3.pdb.gz	Q9UAQ3_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=2
6	AFDB:Q9UJV3	0.304	0.296	2.118E-44	735	0.254	0.245	Q9UJV3.pdb.gz	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
7	AFDB:O70583	0.294	0.304	6.537E-44	680	0.258	0.269	O70583.pdb.gz	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
8	AFDB:Q80WG7	0.246	0.242	1.015E-41	729	0.238	0.232	Q80WG7.pdb.gz	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
9	AFDB:A1L4K1	0.213	0.203	9.231E-29	749	0.193	0.183	A1L4K1.pdb.gz	FSD2_HUMAN Fibronectin type III and SPRY domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FSD2 PE=1 SV=1
10	AFDB:Q1LY10	0.264	0.339	3.022E-27	495	0.146	0.210	Q1LY10.pdb.gz	FSD1_DANRE Fibronectin type III and SPRY domain-containing protein 1 OS=Danio rerio OX=7955 GN=fsd1 PE=3 SV=1
11	PDB:7ccbA	0.194	0.793	1.516E-10	164	0.039	0.171	7ccbA.pdb.gz
12	PDB:7y4sA	0.195	0.385	3.047E-10	343	0.090	0.187	7y4sA.pdb.gz
13	PDB:7nscA	0.223	0.550	1.047E-9	276	0.054	0.138	7nscA.pdb.gz
14	PDB:4b3nA	0.186	0.233	6.525E-8	557	0.039	0.050	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
15	PDB:6swy1	0.181	0.232	2.014E-7	542	0.039	0.052	6swy1.pdb.gz
16	PDB:6venO	0.198	0.430	2.125E-7	315	0.054	0.121	6venO.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
17	PDB:7tzcA	0.169	0.028	1.318E-6	4404	0.041	0.007	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
18	PDB:7ua3A	0.170	0.028	1.723E-6	4443	0.042	0.007	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.
19	PDB:7z36B	0.208	0.313	1.918E-6	446	0.062	0.099	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
20	PDB:7m6aA	0.167	0.028	2.509E-6	4306	0.045	0.007	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M9MRI4	0.0	592	740	0.411	0.395	TRIM9_DROME E3 ubiquitin-protein ligase TRIM9 OS=Drosophila melanogaster OX=7227 GN=Trim9 PE=1 SV=1
2	Q505D9	0.0	967	768	0.680	0.629	TRI67_MOUSE Tripartite motif-containing protein 67 OS=Mus musculus OX=10090 GN=Trim67 PE=2 SV=1
3	Q8C7M3	0.0	1102	817	0.745	0.647	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
4	Q91ZY8	0.0	1466	710	0.979	0.979	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
5	Q9C026	0.0	1490	710	1.000	1.000	TRIM9_HUMAN E3 ubiquitin-protein ligase TRIM9 OS=Homo sapiens OX=9606 GN=TRIM9 PE=1 SV=1
6	B1GRL4	4.77e-173	515	751	0.413	0.390	B1GRL4_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=1
7	Q9UAQ3	1.87e-172	514	765	0.415	0.386	Q9UAQ3_CAEEL E3 ubiquitin-protein ligase TRIM9 OS=Caenorhabditis elegans OX=6239 GN=madd-2 PE=4 SV=2
8	Q9NQ86	4.18e-54	200	728	0.231	0.225	TRI36_HUMAN E3 ubiquitin-protein ligase TRIM36 OS=Homo sapiens OX=9606 GN=TRIM36 PE=1 SV=2
9	Q80WG7	1.28e-52	196	729	0.242	0.236	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
10	O15344	6.34e-52	193	667	0.238	0.253	TRI18_HUMAN E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
11	O70583	5.38e-50	188	680	0.241	0.251	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
12	Q9UJV3	8.91e-49	185	735	0.230	0.222	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
13	Q7TNM2	5.95e-45	174	759	0.238	0.223	TRI46_MOUSE Tripartite motif-containing protein 46 OS=Mus musculus OX=10090 GN=Trim46 PE=1 SV=1
14	A0A0G2JXN2	7.81e-45	174	759	0.234	0.219	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
15	C9J453	1.28e-36	146	483	0.163	0.240	C9J453_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
16	Q1LY10	8.94e-19	92.4	495	0.145	0.208	FSD1_DANRE Fibronectin type III and SPRY domain-containing protein 1 OS=Danio rerio OX=7955 GN=fsd1 PE=3 SV=1
17	Q9BTV5	1.07e-17	89.0	496	0.139	0.200	FSD1_HUMAN Fibronectin type III and SPRY domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FSD1 PE=1 SV=1
18	Q9ERP3	4.22e-17	85.9	366	0.111	0.216	TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus OX=10090 GN=Trim54 PE=1 SV=1
19	Q91Z63	5.51e-17	85.5	351	0.101	0.205	TRI63_RAT E3 ubiquitin-protein ligase TRIM63 OS=Rattus norvegicus OX=10116 GN=Trim63 PE=2 SV=1
20	Q969Q1	2.31e-16	83.6	353	0.097	0.195	TRI63_HUMAN E3 ubiquitin-protein ligase TRIM63 OS=Homo sapiens OX=9606 GN=TRIM63 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	1.1e-05	37.0	Fibronectin type III domain
2	PF13765 PRY	1.2	20.1	SPRY-associated domain
3	PF00622 SPRY	5.9e-10	50.7	SPRY domain
4	PF00643 zf-B_box	0.00076	30.9	B-box zinc finger
5	PF00097 zf-C3HC4	0.0094	27.1	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	0.062	24.4	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.0054	27.9	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	0.5	21.8	zinc finger of C3HC4-type, RING
9	PF13639 zf-RING_2	10	17.9	Ring finger domain
10	PF14634 zf-RING_5	0.29	22.5	zinc-RING finger domain
11	PF13445 zf-RING_UBOX	0.014	26.8	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298355

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000389140	0.975	Netrin receptor DCC
2	9606.ENSP00000254976	0.957	Synaptosomal-associated protein 25
3	9606.ENSP00000359206	0.931	F-box/WD repeat-containing protein 1A
4	9606.ENSP00000245932	0.771	Vasodilator-stimulated phosphoprotein
5	9606.ENSP00000341198	0.761	Neogenin
6	9606.ENSP00000338348	0.758	Ubiquitin-conjugating enzyme E2 G2
7	9606.ENSP00000173229	0.749	Netrin-1
8	9606.ENSP00000263182	0.748	Gamma-butyrobetaine dioxygenase
9	9606.ENSP00000295756	0.689	T-cell receptor-associated transmembrane adapter 1
10	9606.ENSP00000383303	0.689	Down syndrome cell adhesion molecule
11	9606.ENSP00000355658	0.654	E3 ubiquitin-protein ligase TRIM17
12	9606.ENSP00000425658	0.618	Ankyrin repeat domain-containing protein 50
13	9606.ENSP00000265094	0.617	F-box/WD repeat-containing protein 11
14	9606.ENSP00000233712	0.600	Protein eva-1 homolog A
15	9606.ENSP00000329967	0.577	Serine/threonine-protein kinase TBK1
16	9606.ENSP00000376652	0.569	Ena/VASP-like protein
17	9606.ENSP00000340998	0.560	Netrin-4
18	9606.ENSP00000339449	0.556	Cilia- and flagella-associated protein 52
19	9606.ENSP00000299413	0.552	Tripartite motif-containing protein 44
20	9606.ENSP00000421076	0.546	ATP synthase subunit g 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140096	0.697	catalytic activity, acting on a protein
GO:0019787	0.621	ubiquitin-like protein transferase activity
GO:0004842	0.541	ubiquitin-protein transferase activity
GO:0000149	0.469	SNARE binding
GO:0042802	0.356	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0009987	0.988	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0071704	0.909	organic substance metabolic process
GO:0044238	0.900	primary metabolic process
GO:0006807	0.882	nitrogen compound metabolic process
GO:0043170	0.873	macromolecule metabolic process
GO:0044237	0.861	cellular metabolic process
GO:1901564	0.850	organonitrogen compound metabolic process
GO:0019538	0.836	protein metabolic process
GO:0006508	0.797	proteolysis
GO:0043632	0.764	modification-dependent macromolecule catabolic process
GO:0048519	0.762	negative regulation of biological process
GO:0030163	0.710	protein catabolic process
GO:0065008	0.701	regulation of biological quality
GO:0051603	0.696	proteolysis involved in protein catabolic process
GO:0048523	0.687	negative regulation of cellular process
GO:0007154	0.672	cell communication
GO:0050896	0.652	response to stimulus
GO:0051128	0.651	regulation of cellular component organization
GO:0010498	0.638	proteasomal protein catabolic process
GO:0051179	0.634	localization
GO:0023052	0.624	signaling
GO:0006810	0.615	transport
GO:0032879	0.611	regulation of localization
GO:0006887	0.582	exocytosis
GO:0007267	0.565	cell-cell signaling
GO:0019941	0.552	modification-dependent protein catabolic process
GO:0006836	0.548	neurotransmitter transport
GO:0016079	0.525	synaptic vesicle exocytosis
GO:0006511	0.506	ubiquitin-dependent protein catabolic process
GO:0033043	0.467	regulation of organelle organization
GO:0019222	0.460	regulation of metabolic process
GO:0051049	0.448	regulation of transport
GO:1903530	0.442	regulation of secretion by cell
GO:0017157	0.433	regulation of exocytosis
GO:0048518	0.420	positive regulation of biological process
GO:0017158	0.419	regulation of calcium ion-dependent exocytosis
GO:0010646	0.407	regulation of cell communication
GO:0023051	0.404	regulation of signaling
GO:0048583	0.370	regulation of response to stimulus
GO:0060255	0.358	regulation of macromolecule metabolic process
GO:0048522	0.357	positive regulation of cellular process
GO:0031338	0.356	regulation of vesicle fusion
GO:0080090	0.327	regulation of primary metabolic process
GO:0031323	0.317	regulation of cellular metabolic process
GO:0009966	0.311	regulation of signal transduction
GO:0051171	0.307	regulation of nitrogen compound metabolic process
GO:0043412	0.306	macromolecule modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.940	cytosol
GO:0043226	0.924	organelle
GO:0043229	0.895	intracellular organelle
GO:0043227	0.871	membrane-bounded organelle
GO:0042995	0.777	cell projection
GO:0120025	0.764	plasma membrane bounded cell projection
GO:0043231	0.750	intracellular membrane-bounded organelle
GO:0043005	0.720	neuron projection
GO:0097447	0.621	dendritic tree
GO:0016020	0.511	membrane
GO:0043232	0.467	intracellular non-membrane-bounded organelle
GO:0012505	0.350	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.621	Transferases.

[back to server]