StarFunc result for job id Q9C030

User Input

>input (488 residues)
MTSPVLVDIREEVTCPICLELLTEPLSIDCGHSFCQACITPNGRESVIGQEGERSCPVCQ
TSYQPGNLRPNRHLANIVRRLREVVLGPGKQLKAVLCADHGEKLQLFCQEDGKVICWLCE
RSQEHRGHHTFLVEEVAQEYQEKFQESLKKLKNEEQEAEKLTAFIREKKTSWKNQMEPER
CRIQTEFNQLRNILDRVEQRELKKLEQEEKKGLRIIEEAENDLVHQTQSLRELISDLERR
CQGSTMELLQDVSDVTERSEFWTLRKPEALPTKLRSMFRAPDLKRMLRVCRELTDVQSYW
VDVTLNPHTANLNLVLAKNRRQVRFVGAKVSGPSCLEKHYDCSVLGSQHFSSGKHYWEVD
VAKKTAWILGVCSNSLGPTFSFNHFAQNHSAYSRYQPQSGYWVIGLQHNHEYRAYEDSSP
SLLLSMTVPPRRVGVFLDYEAGTVSFYNVTNHGFPIYTFSKYYFPTTLCPYFNPCNCVIP
MTLRRPSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C030	1.000	1.000	1.352E-92	488	1.000	1.000	Q9C030.pdb.gz	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
2	AFDB:Q8BGE7	0.771	0.771	3.533E-78	488	0.801	0.801	Q8BGE7.pdb.gz	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
3	AFDB:Q8IYM9	0.759	0.744	1.594E-60	498	0.584	0.572	Q8IYM9.pdb.gz	TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens OX=9606 GN=TRIM22 PE=1 SV=1
4	AFDB:Q5D7I0	0.670	0.663	4.434E-59	494	0.568	0.561	Q5D7I0.pdb.gz	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
5	AFDB:Q9BYJ4	0.704	0.704	6.255E-59	488	0.600	0.600	Q9BYJ4.pdb.gz	TRI34_HUMAN E3 ubiquitin-protein ligase TRIM34 OS=Homo sapiens OX=9606 GN=TRIM34 PE=1 SV=2
6	AFDB:Q5C8U3	0.725	0.689	4.928E-58	515	0.566	0.536	Q5C8U3.pdb.gz	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
7	AFDB:Q9C035	0.677	0.671	1.233E-57	493	0.572	0.566	Q9C035.pdb.gz	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
8	AFDB:Q587N6	0.619	0.612	1.551E-57	495	0.566	0.558	Q587N6.pdb.gz	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
9	AFDB:P15533	0.678	0.668	1.309E-51	496	0.451	0.444	P15533.pdb.gz	TR30A_MOUSE Tripartite motif-containing protein 30A OS=Mus musculus OX=10090 GN=Trim30a PE=1 SV=2
10	AFDB:P19474	0.344	0.352	1.573E-46	475	0.451	0.463	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
11	PDB:4b3nA	0.335	0.295	9.149E-23	557	0.193	0.169	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
12	PDB:7y4sA	0.338	0.473	2.994E-20	343	0.150	0.213	7y4sA.pdb.gz
13	PDB:4tn3B	0.360	0.474	1.345E-14	362	0.227	0.307	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
14	PDB:7z36B	0.280	0.301	8.443E-8	446	0.098	0.108	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
15	PDB:7ccbA	0.241	0.656	1.336E-7	164	0.055	0.165	7ccbA.pdb.gz
16	PDB:7nscA	0.277	0.459	4.948E-6	276	0.055	0.098	7nscA.pdb.gz
17	PDB:6swy1	0.207	0.188	1.389E-5	542	0.055	0.050	6swy1.pdb.gz
18	PDB:7nsba	0.220	0.191	2.738E-4	568	0.064	0.055	7nsba.pdb.gz
19	PDB:5t15B	0.203	0.026	2.157E-3	4170	0.039	0.005	5t15B.pdb.gz	Structural Basis for Gating and Activation of RyR1.
20	PDB:4r8pL	0.138	0.250	2.562E-3	254	0.051	0.098	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0PF16	0.0	535	497	0.564	0.553	TRIM5_MACMU Tripartite motif-containing protein 5 OS=Macaca mulatta OX=9544 GN=TRIM5 PE=1 SV=2
2	Q587N6	0.0	535	495	0.566	0.558	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
3	Q5C8U3	0.0	532	515	0.572	0.542	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
4	Q5C8U4	0.0	531	515	0.572	0.542	TRIM5_CHLPG Tripartite motif-containing protein 5 OS=Chlorocebus pygerythrus OX=60710 GN=TRIM5 PE=2 SV=1
5	Q5D7I0	0.0	521	494	0.568	0.561	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
6	Q8BGE7	0.0	835	488	0.801	0.801	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
7	Q8IYM9	0.0	555	498	0.588	0.576	TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens OX=9606 GN=TRIM22 PE=1 SV=1
8	Q9C030	0.0	1017	488	1.000	1.000	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
9	Q9C035	0.0	535	493	0.582	0.576	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
10	Q9BYJ4	4.21e-174	500	488	0.602	0.602	TRI34_HUMAN E3 ubiquitin-protein ligase TRIM34 OS=Homo sapiens OX=9606 GN=TRIM34 PE=1 SV=2
11	P19474	2.14e-135	401	475	0.443	0.455	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
12	P15533	6.78e-132	393	496	0.461	0.454	TR30A_MOUSE Tripartite motif-containing protein 30A OS=Mus musculus OX=10090 GN=Trim30a PE=1 SV=2
13	Q3U7K7	2.17e-121	365	462	0.404	0.426	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
14	Q62191	4.03e-121	364	470	0.400	0.415	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
15	Q6AZZ1	1.02e-112	343	485	0.385	0.388	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
16	Q5NCC9	1.67e-96	301	485	0.383	0.386	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
17	O00635	1.16e-92	291	465	0.369	0.387	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
18	Q96F44	5.39e-85	271	468	0.363	0.378	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
19	A0A1U9X8R9	1.87e-81	263	513	0.352	0.335	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
20	P14373	1.87e-81	263	513	0.352	0.335	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19697 Atg11_middle	2.4e+02	13.3	Atg11 middle domain
2	PF16046 FAM76	0.57	21.1	FAM76 protein
3	PF08702 Fib_alpha	2e+02	13.5	Fibrinogen alpha/beta chain family
4	PF13765 PRY	0.074	24.0	SPRY-associated domain
5	PF00622 SPRY	7.1e-07	40.7	SPRY domain
6	PF04564 U-box	4.7e+02	12.4	U-box domain
7	PF15750 UBZ_FAAP20	1.1e+02	14.1	Ubiquitin-binding zinc-finger
8	PF00643 zf-B_box	8.2e-06	37.2	B-box zinc finger
9	PF00097 zf-C3HC4	3.3e-06	38.2	Zinc finger, C3HC4 type (RING finger)
10	PF13923 zf-C3HC4_2	3.8e-05	34.7	Zinc finger, C3HC4 type (RING finger)
11	PF13920 zf-C3HC4_3	0.081	24.1	Zinc finger, C3HC4 type (RING finger)
12	PF15227 zf-C3HC4_4	2.7e-06	38.7	zinc finger of C3HC4-type, RING
13	PF11789 zf-Nse	36	15.7	Zinc-finger of the MIZ type in Nse subunit
14	PF16685 zf-RING_10	43	15.7	zinc RING finger of MSL2
15	PF13639 zf-RING_2	0.0083	27.8	Ring finger domain
16	PF14634 zf-RING_5	0.0018	29.6	zinc-RING finger domain
17	PF13445 zf-RING_UBOX	2.5e-08	45.1	RING-type zinc-finger
18	PF14569 zf-UDP	2.8e+02	13.0	Zinc-binding RING-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369440

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295756	0.724	T-cell receptor-associated transmembrane adapter 1
2	9606.ENSP00000369373	0.707	Tripartite motif-containing protein 5
3	9606.ENSP00000263182	0.656	Gamma-butyrobetaine dioxygenase
4	9606.ENSP00000231524	0.597	E3 ubiquitin-protein ligase TRIM23
5	9606.ENSP00000464030	0.507	Inhibitor of nuclear factor kappa-B kinase subunit epsilon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0042802	0.992	identical protein binding
GO:0019901	0.990	protein kinase binding
GO:0003824	0.989	catalytic activity
GO:0140096	0.961	catalytic activity, acting on a protein
GO:0004842	0.952	ubiquitin-protein transferase activity
GO:1990782	0.921	protein tyrosine kinase binding
GO:0030674	0.905	protein-macromolecule adaptor activity
GO:0061630	0.763	ubiquitin protein ligase activity
GO:0003712	0.719	transcription coregulator activity
GO:0003713	0.438	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0050896	0.991	response to stimulus
GO:0019222	0.991	regulation of metabolic process
GO:0048583	0.988	regulation of response to stimulus
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0050792	0.969	regulation of viral process
GO:0048518	0.967	positive regulation of biological process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0010468	0.957	regulation of gene expression
GO:0051171	0.944	regulation of nitrogen compound metabolic process
GO:0080090	0.941	regulation of primary metabolic process
GO:0009615	0.936	response to virus
GO:0048519	0.935	negative regulation of biological process
GO:0048522	0.931	positive regulation of cellular process
GO:0002831	0.926	regulation of response to biotic stimulus
GO:0023051	0.922	regulation of signaling
GO:0010646	0.918	regulation of cell communication
GO:0071704	0.916	organic substance metabolic process
GO:0045088	0.909	regulation of innate immune response
GO:0009966	0.898	regulation of signal transduction
GO:0009987	0.897	cellular process
GO:1903900	0.887	regulation of viral life cycle
GO:0050778	0.876	positive regulation of immune response
GO:0009889	0.874	regulation of biosynthetic process
GO:0002833	0.866	positive regulation of response to biotic stimulus
GO:0019219	0.858	regulation of nucleobase-containing compound metabolic process
GO:0045089	0.857	positive regulation of innate immune response
GO:0048525	0.848	negative regulation of viral process
GO:0006807	0.842	nitrogen compound metabolic process
GO:0044238	0.832	primary metabolic process
GO:0051090	0.829	regulation of DNA-binding transcription factor activity
GO:0060759	0.803	regulation of response to cytokine stimulus
GO:0044093	0.790	positive regulation of molecular function
GO:0051091	0.776	positive regulation of DNA-binding transcription factor activity
GO:0006950	0.770	response to stress
GO:0045071	0.761	negative regulation of viral genome replication
GO:0023056	0.754	positive regulation of signaling
GO:0010647	0.754	positive regulation of cell communication
GO:0043170	0.734	macromolecule metabolic process
GO:1901564	0.722	organonitrogen compound metabolic process
GO:0009893	0.687	positive regulation of metabolic process
GO:0010604	0.682	positive regulation of macromolecule metabolic process
GO:0009967	0.669	positive regulation of signal transduction
GO:0060338	0.641	regulation of type I interferon-mediated signaling pathway
GO:0060760	0.635	positive regulation of response to cytokine stimulus
GO:0001961	0.549	positive regulation of cytokine-mediated signaling pathway
GO:0051607	0.526	defense response to virus
GO:0044237	0.508	cellular metabolic process
GO:0019538	0.473	protein metabolic process
GO:0043412	0.466	macromolecule modification
GO:0036211	0.416	protein modification process
GO:0032446	0.413	protein modification by small protein conjugation
GO:0006955	0.325	immune response
GO:0048523	0.311	negative regulation of cellular process
GO:0010628	0.303	positive regulation of gene expression
GO:0016567	0.301	protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0005829	0.966	cytosol
GO:0005634	0.961	nucleus
GO:0070013	0.501	intracellular organelle lumen
GO:0031981	0.478	nuclear lumen
GO:0005654	0.426	nucleoplasm
GO:0012505	0.403	endomembrane system
GO:0016020	0.329	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.952	Transferases.

[back to server]