StarFunc result for job id Q9C035

User Input

>input (493 residues)
MASGILVNVKEEVTCPICLELLTQPLSLDCGHSFCQACLTANHKKSMLDKGESSCPVCRI
SYQPENIRPNRHVANIVEKLREVKLSPEGQKVDHCARHGEKLLLFCQEDGKVICWLCERS
QEHRGHHTFLTEEVAREYQVKLQAALEMLRQKQQEAEELEADIREEKASWKTQIQYDKTN
VLADFEQLRDILDWEESNELQNLEKEEEDILKSLTNSETEMVQQTQSLRELISDLEHRLQ
GSVMELLQGVDGVIKRTENVTLKKPETFPKNQRRVFRAPDLKGMLEVFRELTDVRRYWVD
VTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQSITSGKHY
WEVDVSKKTAWILGVCAGFQPDAMCNIEKNENYQPKYGYWVIGLEEGVKCSAFQDSSFHT
PSVPFIVPLSVIICPDRVGVFLDYEACTVSFFNITNHGFLIYKFSHCSFSQPVFPYLNPR
KCGVPMTLCSPSS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C035	1.000	1.000	4.220E-95	493	1.000	1.000	Q9C035.pdb.gz	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
2	AFDB:Q587N6	0.895	0.892	1.213E-82	495	0.874	0.871	Q587N6.pdb.gz	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
3	AFDB:Q5C8U3	0.721	0.692	3.527E-79	515	0.870	0.833	Q5C8U3.pdb.gz	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
4	AFDB:Q5D7I0	0.756	0.754	7.669E-68	494	0.680	0.678	Q5D7I0.pdb.gz	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
5	AFDB:Q9BYJ4	0.775	0.782	1.807E-59	488	0.582	0.588	Q9BYJ4.pdb.gz	TRI34_HUMAN E3 ubiquitin-protein ligase TRIM34 OS=Homo sapiens OX=9606 GN=TRIM34 PE=1 SV=2
6	AFDB:Q8IYM9	0.698	0.691	5.692E-59	498	0.552	0.546	Q8IYM9.pdb.gz	TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens OX=9606 GN=TRIM22 PE=1 SV=1
7	AFDB:Q9C030	0.670	0.676	9.007E-59	488	0.568	0.574	Q9C030.pdb.gz	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
8	AFDB:Q8BGE7	0.702	0.708	4.755E-58	488	0.540	0.545	Q8BGE7.pdb.gz	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
9	AFDB:P15533	0.751	0.747	1.464E-54	496	0.465	0.462	P15533.pdb.gz	TR30A_MOUSE Tripartite motif-containing protein 30A OS=Mus musculus OX=10090 GN=Trim30a PE=1 SV=2
10	AFDB:P19474	0.364	0.377	1.733E-46	475	0.418	0.434	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
11	PDB:4b3nA	0.368	0.327	1.688E-32	557	0.351	0.311	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
12	PDB:4tn3B	0.364	0.486	3.272E-21	362	0.353	0.481	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
13	PDB:7y4sA	0.323	0.452	7.562E-18	343	0.148	0.213	7y4sA.pdb.gz
14	PDB:7z36B	0.267	0.292	1.887E-9	446	0.112	0.123	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
15	PDB:6swy1	0.213	0.196	7.309E-6	542	0.071	0.065	6swy1.pdb.gz
16	PDB:7ccbA	0.226	0.614	8.197E-6	164	0.049	0.146	7ccbA.pdb.gz
17	PDB:7nscA	0.231	0.386	6.467E-5	276	0.055	0.098	7nscA.pdb.gz
18	PDB:7nsba	0.215	0.190	9.663E-5	568	0.069	0.060	7nsba.pdb.gz
19	PDB:7jzvA	0.153	0.287	4.817E-4	253	0.047	0.091	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
20	PDB:5dkaA	0.113	0.514	5.102E-4	96	0.051	0.260	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0PF16	0.0	895	497	0.876	0.869	TRIM5_MACMU Tripartite motif-containing protein 5 OS=Macaca mulatta OX=9544 GN=TRIM5 PE=1 SV=2
2	Q587N6	0.0	902	495	0.876	0.873	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
3	Q5C8U3	0.0	881	515	0.876	0.839	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
4	Q5C8U4	0.0	879	515	0.870	0.833	TRIM5_CHLPG Tripartite motif-containing protein 5 OS=Chlorocebus pygerythrus OX=60710 GN=TRIM5 PE=2 SV=1
5	Q5D7I0	0.0	678	494	0.684	0.682	TRIM5_SAISC Tripartite motif-containing protein 5 OS=Saimiri sciureus OX=9521 GN=TRIM5 PE=3 SV=1
6	Q8IYM9	0.0	528	498	0.556	0.550	TRI22_HUMAN E3 ubiquitin-protein ligase TRIM22 OS=Homo sapiens OX=9606 GN=TRIM22 PE=1 SV=1
7	Q9C030	0.0	535	488	0.576	0.582	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
8	Q9C035	0.0	1028	493	1.000	1.000	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
9	Q8BGE7	2.55e-180	516	488	0.550	0.555	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
10	Q9BYJ4	7.25e-171	492	488	0.582	0.588	TRI34_HUMAN E3 ubiquitin-protein ligase TRIM34 OS=Homo sapiens OX=9606 GN=TRIM34 PE=1 SV=2
11	P15533	1.53e-149	438	496	0.479	0.476	TR30A_MOUSE Tripartite motif-containing protein 30A OS=Mus musculus OX=10090 GN=Trim30a PE=1 SV=2
12	P19474	4.25e-113	344	475	0.408	0.423	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
13	Q3U7K7	2.14e-102	316	462	0.363	0.387	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
14	Q62191	7.63e-102	315	470	0.359	0.377	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
15	Q6AZZ1	2.72e-93	293	485	0.361	0.367	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
16	Q99PQ1	1.23e-87	272	284	0.274	0.475	TR12A_MOUSE Tripartite motif-containing protein 12A OS=Mus musculus OX=10090 GN=Trim12a PE=2 SV=1
17	Q5NCC9	1.49e-85	273	485	0.343	0.348	TRI58_MOUSE E3 ubiquitin-protein ligase TRIM58 OS=Mus musculus OX=10090 GN=Trim58 PE=2 SV=1
18	O00635	1.91e-77	251	465	0.325	0.344	TRI38_HUMAN E3 ubiquitin-protein ligase TRIM38 OS=Homo sapiens OX=9606 GN=TRIM38 PE=1 SV=1
19	Q96F44	2.95e-76	249	468	0.347	0.365	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
20	Q99PQ2	1.43e-74	244	467	0.345	0.364	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05290 Baculo_IE-1	9.9e+02	11.1	Baculovirus immediate-early protein (IE-0)
2	PF13991 BssS	2.2e+02	13.3	BssS protein family
3	PF16046 FAM76	9.9	17.1	FAM76 protein
4	PF00622 SPRY	7.1e-07	40.7	SPRY domain
5	PF12325 TMF_TATA_bd	0.049	25.1	TATA element modulatory factor 1 TATA binding
6	PF04564 U-box	10	17.7	U-box domain
7	PF00643 zf-B_box	0.00033	32.0	B-box zinc finger
8	PF00097 zf-C3HC4	1.2e-05	36.4	Zinc finger, C3HC4 type (RING finger)
9	PF13923 zf-C3HC4_2	0.0002	32.4	Zinc finger, C3HC4 type (RING finger)
10	PF13920 zf-C3HC4_3	0.0085	27.2	Zinc finger, C3HC4 type (RING finger)
11	PF15227 zf-C3HC4_4	9.7e-07	40.1	zinc finger of C3HC4-type, RING
12	PF11789 zf-Nse	1.9e+02	13.4	Zinc-finger of the MIZ type in Nse subunit
13	PF16685 zf-RING_10	40	15.8	zinc RING finger of MSL2
14	PF13639 zf-RING_2	0.00077	31.1	Ring finger domain
15	PF14570 zf-RING_4	16	16.7	RING/Ubox like zinc-binding domain
16	PF14634 zf-RING_5	0.0034	28.6	zinc-RING finger domain
17	PF13445 zf-RING_UBOX	4.4e-08	44.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369373

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000316176	0.994	Ubiquitin-conjugating enzyme E2 N
2	9606.ENSP00000419425	0.940	Peptidyl-prolyl cis-trans isomerase A
3	9606.ENSP00000261721	0.923	BTB/POZ domain-containing protein 1
4	9606.ENSP00000255608	0.918	BTB/POZ domain-containing protein 2
5	9606.ENSP00000385057	0.890	DNA dC->dU-editing enzyme APOBEC-3G
6	9606.ENSP00000252593	0.863	Bone marrow stromal antigen 2
7	9606.ENSP00000295756	0.857	T-cell receptor-associated transmembrane adapter 1
8	9606.ENSP00000262878	0.852	Deoxynucleoside triphosphate triphosphohydrolase SAMHD1
9	9606.ENSP00000356426	0.852	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
10	9606.ENSP00000011653	0.849	T-cell surface glycoprotein CD4
11	9606.ENSP00000263182	0.837	Gamma-butyrobetaine dioxygenase
12	9606.ENSP00000335261	0.830	Trimethyllysine dioxygenase, mitochondrial
13	9606.ENSP00000381717	0.830	Ubiquitin-conjugating enzyme E2 D2
14	9606.ENSP00000376077	0.774	Small ubiquitin-related modifier 1
15	9606.ENSP00000391211	0.768	26S proteasome regulatory subunit 7
16	9606.ENSP00000363055	0.766	ZW10 interactor
17	9606.ENSP00000327459	0.755	DNA dC->dU-editing enzyme APOBEC-3B
18	9606.ENSP00000333657	0.728	Interferon-induced GTP-binding protein Mx2
19	9606.ENSP00000374455	0.715	Sequestosome-1
20	9606.ENSP00000309749	0.712	DNA dC->dU-editing enzyme APOBEC-3F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0042802	0.993	identical protein binding
GO:0003824	0.974	catalytic activity
GO:0019899	0.964	enzyme binding
GO:0019787	0.964	ubiquitin-like protein transferase activity
GO:0004842	0.951	ubiquitin-protein transferase activity
GO:0019900	0.894	kinase binding
GO:0019901	0.881	protein kinase binding
GO:0003712	0.837	transcription coregulator activity
GO:0038187	0.836	pattern recognition receptor activity
GO:0046983	0.833	protein dimerization activity
GO:0030674	0.826	protein-macromolecule adaptor activity
GO:0042803	0.819	protein homodimerization activity
GO:0003713	0.818	transcription coactivator activity
GO:0061630	0.448	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0006950	0.986	response to stress
GO:0009615	0.985	response to virus
GO:0050794	0.979	regulation of cellular process
GO:0051607	0.957	defense response to virus
GO:0048518	0.867	positive regulation of biological process
GO:0019222	0.855	regulation of metabolic process
GO:0009987	0.798	cellular process
GO:0060255	0.762	regulation of macromolecule metabolic process
GO:0031323	0.716	regulation of cellular metabolic process
GO:0051171	0.707	regulation of nitrogen compound metabolic process
GO:0048583	0.701	regulation of response to stimulus
GO:0008152	0.700	metabolic process
GO:0080090	0.693	regulation of primary metabolic process
GO:0048519	0.666	negative regulation of biological process
GO:0071704	0.643	organic substance metabolic process
GO:0010468	0.628	regulation of gene expression
GO:0048522	0.616	positive regulation of cellular process
GO:0044238	0.610	primary metabolic process
GO:0006807	0.590	nitrogen compound metabolic process
GO:0050792	0.527	regulation of viral process
GO:0043170	0.513	macromolecule metabolic process
GO:1903900	0.501	regulation of viral life cycle
GO:1901564	0.488	organonitrogen compound metabolic process
GO:0048525	0.463	negative regulation of viral process
GO:0043412	0.443	macromolecule modification
GO:0019538	0.443	protein metabolic process
GO:0010646	0.435	regulation of cell communication
GO:0009966	0.433	regulation of signal transduction
GO:0048584	0.429	positive regulation of response to stimulus
GO:0019219	0.415	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.411	regulation of RNA metabolic process
GO:0002376	0.410	immune system process
GO:0031326	0.397	regulation of cellular biosynthetic process
GO:0010556	0.384	regulation of macromolecule biosynthetic process
GO:0044237	0.379	cellular metabolic process
GO:0006955	0.356	immune response
GO:0065009	0.352	regulation of molecular function
GO:0045087	0.342	innate immune response
GO:0009893	0.323	positive regulation of metabolic process
GO:2001141	0.323	regulation of RNA biosynthetic process
GO:0080134	0.320	regulation of response to stress
GO:0036211	0.314	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.992	intracellular non-membrane-bounded organelle
GO:0005829	0.987	cytosol
GO:0043231	0.958	intracellular membrane-bounded organelle
GO:0070013	0.957	intracellular organelle lumen
GO:0005634	0.815	nucleus
GO:0031981	0.524	nuclear lumen
GO:0012505	0.398	endomembrane system
GO:0000932	0.367	P-body
GO:0005654	0.349	nucleoplasm
GO:0016020	0.324	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.964	Transferases.

[back to server]