StarFunc result for job id Q9C056

User Input

>input (277 residues)
MDTNRPGAFVLSSAPLAALHNMAEMKTSLFPYALQGPAGFKAPALGGLGAQLPLGTPHGI
SDILGRPVGAAGGGLLGGLPRLNGLASSAGVYFGPAAAVARGYPKPLAELPGRPPIFWPG
VVQGAPWRDPRLAGPAPAGGVLDKDGKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERAR
LAYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKKKQDSDAEKLKVGGSDAEDDDEYNR
PLDPNSDDEKITRLLKKHKPSNLALVSPCGGGAGDAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z4R4	0.457	0.457	3.229E-37	277	0.968	0.968	D3Z4R4.pdb.gz	D3Z4R4_MOUSE NK6 homeobox 2 OS=Mus musculus OX=10090 GN=Nkx6-2 PE=4 SV=1
2	AFDB:A0A0R4IY89	0.425	0.424	2.105E-30	278	0.773	0.770	A0A0R4IY89.pdb.gz	A0A0R4IY89_DANRE Homeobox protein Nkx-6.2 OS=Danio rerio OX=7955 GN=nkx6.2 PE=4 SV=1
3	AFDB:F1QUC3	0.375	0.337	1.946E-24	312	0.653	0.580	F1QUC3.pdb.gz
4	AFDB:A6NJ46	0.271	0.282	1.481E-16	265	0.495	0.517	A6NJ46.pdb.gz	NKX63_HUMAN Homeobox protein Nkx-6.3 OS=Homo sapiens OX=9606 GN=NKX6-3 PE=2 SV=1
5	AFDB:Q9NHP8	0.288	0.166	2.585E-12	513	0.397	0.214	Q9NHP8.pdb.gz	Q9NHP8_DROME GTX/Nkx6B-like homeodomain protein OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
6	AFDB:P97436	0.254	0.294	1.127E-8	237	0.227	0.266	P97436.pdb.gz	NKX31_MOUSE Homeobox protein Nkx-3.1 OS=Mus musculus OX=10090 GN=Nkx3-1 PE=1 SV=1
7	AFDB:Q9W7E8	0.247	0.313	1.362E-8	213	0.209	0.272	Q9W7E8.pdb.gz	KOZA_XENLA Homeobox protein koza OS=Xenopus laevis OX=8355 GN=koza PE=2 SV=1
8	AFDB:Q503F2	0.195	0.217	2.255E-8	248	0.206	0.230	Q503F2.pdb.gz	BARX1_DANRE Homeobox protein BarH-like 1 OS=Danio rerio OX=7955 GN=barx1 PE=2 SV=2
9	AFDB:B8A5N9	0.248	0.282	2.724E-8	241	0.242	0.278	B8A5N9.pdb.gz
10	AFDB:B8JMG4	0.233	0.231	3.291E-8	280	0.267	0.264	B8JMG4.pdb.gz
11	PDB:4egcA	0.183	0.094	8.919E-3	539	0.058	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.178	0.606	5.545E-2	73	0.076	0.288	2hi3A.pdb.gz
13	PDB:2vbwA	0.125	0.214	6.474E-1	147	0.083	0.156	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
14	PDB:5aj0BZ	0.148	0.408	8.330E-1	86	0.043	0.140	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
15	PDB:5mrca	0.105	0.156	8.872E-1	177	0.094	0.147	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
16	PDB:2cg4A	0.125	0.213	9.449E-1	149	0.032	0.060	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:5nr5A	0.142	0.319	9.449E-1	113	0.043	0.106	5nr5A.pdb.gz
18	PDB:7fbyA	0.137	0.230	1.072	153	0.029	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
19	PDB:7dcoL	0.134	0.088	1.295	435	0.079	0.051	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:2rvqD	0.085	0.122	1.379	129	0.061	0.132	2rvqD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z4R4	0.0	540	277	0.968	0.968	D3Z4R4_MOUSE NK6 homeobox 2 OS=Mus musculus OX=10090 GN=Nkx6-2 PE=4 SV=1
2	Q9C056	0.0	555	277	1.000	1.000	NKX62_HUMAN Homeobox protein Nkx-6.2 OS=Homo sapiens OX=9606 GN=NKX6-2 PE=1 SV=2
3	A0A0R4IY89	8.87e-158	442	278	0.773	0.770	A0A0R4IY89_DANRE Homeobox protein Nkx-6.2 OS=Danio rerio OX=7955 GN=nkx6.2 PE=4 SV=1
4	Q6DGK5	2.26e-112	328	312	0.650	0.577	Q6DGK5_DANRE Homeobox protein Nkx-6.1 OS=Danio rerio OX=7955 GN=zgc:92879 PE=2 SV=1
5	Q99MA9	1.29e-109	323	365	0.682	0.518	NKX61_MOUSE Homeobox protein Nkx-6.1 OS=Mus musculus OX=10090 GN=Nkx6-1 PE=1 SV=1
6	O35762	3.44e-109	322	365	0.682	0.518	NKX61_RAT Homeobox protein Nkx-6.1 OS=Rattus norvegicus OX=10116 GN=Nkx6-1 PE=2 SV=1
7	P78426	8.39e-109	321	367	0.661	0.499	NKX61_HUMAN Homeobox protein Nkx-6.1 OS=Homo sapiens OX=9606 GN=NKX6-1 PE=1 SV=2
8	Q60554	1.97e-108	320	364	0.675	0.514	NKX61_MESAU Homeobox protein Nkx-6.1 OS=Mesocricetus auratus OX=10036 GN=NKX6-1 PE=1 SV=1
9	Q8CF07	1.03e-96	285	214	0.574	0.743	Q8CF07_MOUSE Homeobox protein Nkx-6.2 OS=Mus musculus OX=10090 GN=Nkx6-2 PE=2 SV=1
10	A6NJ46	9.26e-74	228	265	0.480	0.502	NKX63_HUMAN Homeobox protein Nkx-6.3 OS=Homo sapiens OX=9606 GN=NKX6-3 PE=2 SV=1
11	Q3UHX8	2.34e-73	227	262	0.480	0.508	NKX63_MOUSE Homeobox protein Nkx-6.3 OS=Mus musculus OX=10090 GN=Nkx6-3 PE=2 SV=1
12	Q9YHC2	2.87e-70	215	153	0.394	0.712	Q9YHC2_CHICK Homeodomain protein (Fragment) OS=Gallus gallus OX=9031 GN=Nkx-6.1 PE=2 SV=1
13	Q8SXK1	7.20e-50	172	480	0.390	0.225	Q8SXK1_DROME RE18506p OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
14	Q9NHP8	8.07e-50	173	513	0.390	0.211	Q9NHP8_DROME GTX/Nkx6B-like homeodomain protein OS=Drosophila melanogaster OX=7227 GN=HGTX PE=2 SV=1
15	G5EGF2	1.85e-27	104	106	0.170	0.443	G5EGF2_CAEEL COG-1B OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
16	G5EGE2	1.54e-26	106	256	0.170	0.184	G5EGE2_CAEEL COG-1A OS=Caenorhabditis elegans OX=6239 GN=cog-1 PE=2 SV=1
17	Q504H8	6.92e-18	83.6	297	0.137	0.128	HMX3_DANRE Homeobox protein HMX3 OS=Danio rerio OX=7955 GN=hmx3 PE=2 SV=1
18	Q9DE09	1.07e-17	83.6	333	0.130	0.108	HMX1_CHICK Homeobox protein HMX1 OS=Gallus gallus OX=9031 GN=HMX1 PE=2 SV=1
19	O70218	1.16e-17	83.6	332	0.130	0.108	HMX1_MOUSE Homeobox protein HMX1 OS=Mus musculus OX=10090 GN=Hmx1 PE=2 SV=1
20	Q90461	1.45e-17	81.6	241	0.162	0.187	Q90461_DANRE Floating head OS=Danio rerio OX=7955 GN=flh PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	2.1e-17	74.0	Homeodomain
2	PF12474 PKK	75	14.9	Polo kinase kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357581

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242462	0.874	Neurogenin-3
2	9606.ENSP00000331040	0.810	Oligodendrocyte transcription factor 2
3	9606.ENSP00000295108	0.809	Neurogenic differentiation factor 1
4	9606.ENSP00000365687	0.801	Pancreas transcription factor 1 subunit alpha
5	9606.ENSP00000230658	0.787	Insulin gene enhancer protein ISL-1
6	9606.ENSP00000323568	0.744	Solute carrier family 2, facilitated glucose transporter member 2
7	9606.ENSP00000387662	0.740	Glucagon
8	9606.ENSP00000287641	0.731	Somatostatin
9	9606.ENSP00000400341	0.718	Hepatocyte nuclear factor 3-beta
10	9606.ENSP00000380432	0.706	Insulin
11	9606.ENSP00000371785	0.682	Oligodendrocyte transcription factor 1
12	9606.ENSP00000302630	0.675	Hepatocyte nuclear factor 6
13	9606.ENSP00000362410	0.670	Transcription factor MafB
14	9606.ENSP00000297261	0.664	Sonic hedgehog protein
15	9606.ENSP00000332062	0.648	Sorting nexin-20
16	9606.ENSP00000219204	0.647	ADP-ribosylation factor-like protein 2-binding protein
17	9606.ENSP00000223366	0.643	Glucokinase
18	9606.ENSP00000360811	0.643	LIM/homeobox protein Lhx3
19	9606.ENSP00000245479	0.639	Transcription factor SOX-9
20	9606.ENSP00000301825	0.638	Ectonucleoside triphosphate diphosphohydrolase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0005515	0.991	protein binding
GO:0000977	0.988	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227	0.966	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000987	0.909	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.886	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.994	regulation of cellular process
GO:0032501	0.991	multicellular organismal process
GO:0048856	0.990	anatomical structure development
GO:0009987	0.989	cellular process
GO:0048523	0.979	negative regulation of cellular process
GO:0019222	0.977	regulation of metabolic process
GO:0007275	0.974	multicellular organism development
GO:0080090	0.973	regulation of primary metabolic process
GO:0051171	0.969	regulation of nitrogen compound metabolic process
GO:0060255	0.967	regulation of macromolecule metabolic process
GO:0031323	0.963	regulation of cellular metabolic process
GO:0010468	0.941	regulation of gene expression
GO:0009889	0.938	regulation of biosynthetic process
GO:0048731	0.932	system development
GO:0010556	0.925	regulation of macromolecule biosynthetic process
GO:0031326	0.925	regulation of cellular biosynthetic process
GO:0006355	0.916	regulation of DNA-templated transcription
GO:0048869	0.891	cellular developmental process
GO:0048513	0.887	animal organ development
GO:0030154	0.879	cell differentiation
GO:0009892	0.874	negative regulation of metabolic process
GO:0007399	0.874	nervous system development
GO:0002065	0.863	columnar/cuboidal epithelial cell differentiation
GO:0009890	0.851	negative regulation of biosynthetic process
GO:0010605	0.846	negative regulation of macromolecule metabolic process
GO:0031324	0.841	negative regulation of cellular metabolic process
GO:0031016	0.826	pancreas development
GO:0031327	0.810	negative regulation of cellular biosynthetic process
GO:0006357	0.808	regulation of transcription by RNA polymerase II
GO:0031018	0.798	endocrine pancreas development
GO:0051172	0.783	negative regulation of nitrogen compound metabolic process
GO:0010558	0.778	negative regulation of macromolecule biosynthetic process
GO:0000122	0.770	negative regulation of transcription by RNA polymerase II
GO:0048518	0.713	positive regulation of biological process
GO:0022008	0.695	neurogenesis
GO:0035883	0.647	enteroendocrine cell differentiation
GO:0048522	0.632	positive regulation of cellular process
GO:0007417	0.386	central nervous system development
GO:0050896	0.378	response to stimulus
GO:0010604	0.367	positive regulation of macromolecule metabolic process
GO:0051173	0.356	positive regulation of nitrogen compound metabolic process
GO:0031325	0.356	positive regulation of cellular metabolic process
GO:0010557	0.317	positive regulation of macromolecule biosynthetic process
GO:0045935	0.303	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.302	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.934	intracellular organelle lumen
GO:0031981	0.682	nuclear lumen
GO:0005654	0.389	nucleoplasm
GO:0005737	0.371	cytoplasm
GO:0005829	0.310	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]