StarFunc result for job id Q9C075

User Input

>input (422 residues)
MNSGHSFSQTPSASFHGAGGGWGRPRSFPRAPTVHGGAGGARISLSFTTRSCPPPGGSWG
SGRSSPLLGGNGKATMQNLNDRLASYLEKVRALEEANMKLESRILKWHQQRDPGSKKDYS
QYEENITHLQEQIVDGKMTNAQIILLIDNARMAVDDFNLKYENEHSFKKDLEIEVEGLRR
TLDNLTIVTTDLEQEVEGMRKELILMKKHHEQEMEKHHVPSDFNVNVKVDTGPREDLIKV
LEDMRQEYELIIKKKHRDLDTWYKEQSAAMSQEAASPATVQSRQGDIHELKRTFQALEID
LQTQYSTKSALENMLSETQSRYSCKLQDMQEIISHYEEELTQLRHELERQNNEYQVLLGI
KTHLEKEITTYRRLLEGESEGTREESKSSMKVSATPKIKAITQETINGRLVLCQVNEIQK
HA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C075	1.000	1.000	4.846E-56	422	1.000	1.000	Q9C075.pdb.gz	K1C23_HUMAN Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2
2	AFDB:Q6IFU8	0.306	0.298	1.721E-21	433	0.410	0.400	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
3	AFDB:Q64291	0.302	0.266	1.841E-21	487	0.434	0.376	Q64291.pdb.gz	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
4	AFDB:Q99456	0.316	0.275	1.970E-21	494	0.427	0.364	Q99456.pdb.gz	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
5	AFDB:P02533	0.347	0.314	2.582E-21	472	0.429	0.383	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
6	AFDB:Q61414	0.337	0.317	7.614E-21	452	0.424	0.396	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
7	AFDB:Q9PWD8	0.313	0.308	9.326E-21	429	0.431	0.424	Q9PWD8.pdb.gz	Q9PWD8_DANRE Type I cytokeratin OS=Danio rerio OX=7955 GN=wu:fa03a08 PE=1 SV=1
8	AFDB:Q6PVZ1	0.336	0.306	9.978E-21	467	0.403	0.364	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
9	AFDB:Q6IFV1	0.337	0.298	1.601E-20	485	0.422	0.367	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
10	AFDB:Q1LXJ1	0.310	0.309	1.713E-20	423	0.424	0.423	Q1LXJ1.pdb.gz	Q1LXJ1_DANRE Keratin 17 OS=Danio rerio OX=7955 GN=si:dkeyp-113d7.7 PE=1 SV=1
11	PDB:2wj8N	0.041	0.045	3.600	378	0.012	0.013	2wj8N.pdb.gz	Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
12	PDB:7w59R	0.080	0.120	3.600	280	0.050	0.075	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
13	PDB:3jd5d	0.116	0.230	4.121	176	0.064	0.153	3jd5d.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
14	PDB:6z3eA	0.048	0.081	4.121	237	0.014	0.025	6z3eA.pdb.gz	Crystal structure of GDP-bound human GIMAP5
15	PDB:1u6zB	0.046	0.039	4.409	500	0.002	0.002	1u6zB.pdb.gz
16	PDB:7mjpA	0.043	0.049	4.409	366	0.012	0.014	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
17	PDB:5ondA	0.041	0.110	5.047	135	0.002	0.007	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
18	PDB:8a5yT	0.043	0.030	6.181	650	0.026	0.017	8a5yT.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex and comparison to apo unphosphorylated and phosphorylated states
19	PDB:4iluA	0.042	0.085	6.614	165	0.014	0.036	4iluA.pdb.gz
20	PDB:7b93Z	0.089	0.200	7.076	143	0.050	0.147	7b93Z.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C075	0.0	878	422	1.000	1.000	K1C23_HUMAN Keratin, type I cytoskeletal 23 OS=Homo sapiens OX=9606 GN=KRT23 PE=1 SV=2
2	Q64291	4.23e-105	321	487	0.400	0.347	K1C12_MOUSE Keratin, type I cytoskeletal 12 OS=Mus musculus OX=10090 GN=Krt12 PE=1 SV=2
3	Q9D312	1.59e-104	318	431	0.408	0.399	K1C20_MOUSE Keratin, type I cytoskeletal 20 OS=Mus musculus OX=10090 GN=Krt20 PE=1 SV=1
4	Q04695	4.84e-101	309	432	0.374	0.366	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
5	Q9PWD8	9.32e-101	308	429	0.415	0.408	Q9PWD8_DANRE Type I cytokeratin OS=Danio rerio OX=7955 GN=wu:fa03a08 PE=1 SV=1
6	Q6IFV4	1.64e-100	308	438	0.370	0.356	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
7	A1A4E9	3.16e-100	308	458	0.372	0.343	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
8	Q6IFU8	1.25e-99	305	433	0.372	0.363	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
9	K7ERE3	1.43e-99	305	415	0.370	0.376	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
10	P13646	1.70e-99	306	458	0.370	0.341	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
11	P08730	4.07e-99	304	437	0.370	0.357	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
12	Q9QWL7	4.52e-99	304	433	0.372	0.363	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
13	P08779	1.14e-98	304	473	0.367	0.328	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
14	Q99456	1.93e-98	304	494	0.379	0.324	K1C12_HUMAN Keratin, type I cytoskeletal 12 OS=Homo sapiens OX=9606 GN=KRT12 PE=1 SV=1
15	Q61414	3.69e-97	300	452	0.377	0.352	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
16	Q6IFV3	4.21e-97	300	447	0.365	0.345	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
17	O76013	6.39e-97	300	467	0.393	0.355	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
18	B1AQ75	1.55e-96	299	473	0.415	0.370	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
19	P19012	1.98e-96	298	456	0.360	0.333	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
20	P19001	2.88e-96	296	403	0.379	0.397	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10473 CENP-F_leu_zip	10	17.6	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
2	PF07889 DUF1664	82	14.7	Protein of unknown function (DUF1664)
3	PF06818 Fez1	5.1e+02	12.4	Fez1
4	PF00038 Filament	2.4e-82	288.6	Intermediate filament protein
5	PF02185 HR1	8.3e+02	11.4	Hr1 repeat
6	PF09744 Jnk-SapK_ap_N	5.8e+02	12.2	JNK_SAPK-associated protein-1
7	PF17956 NAPRTase_C	2.5e+02	13.5	Nicotinate phosphoribosyltransferase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000209718

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484331	0.661	Melanoregulin
2	9606.ENSP00000335357	0.630	Cyclin-dependent kinase inhibitor 3
3	9606.ENSP00000347484	0.607	Thrombospondin type-1 domain-containing protein 4
4	9606.ENSP00000257861	0.601	Advillin
5	9606.ENSP00000327234	0.600	Transmembrane and coiled-coil domains 5A
6	9606.ENSP00000460823	0.600	TOM1-like protein 1
7	9606.ENSP00000366984	0.549	Keratin, type I cytoskeletal 40
8	9606.ENSP00000334798	0.540	Keratin, type I cytoskeletal 26
9	9606.ENSP00000246646	0.535	Keratin, type I cuticular Ha8
10	9606.ENSP00000347823	0.533	Keratin, type I cytoskeletal 39
11	9606.ENSP00000305263	0.531	Keratin, type I cytoskeletal 28
12	9606.ENSP00000301656	0.528	Keratin, type I cytoskeletal 27
13	9606.ENSP00000310573	0.526	Keratin, type I cytoskeletal 25
14	9606.ENSP00000225550	0.525	Keratin, type I cuticular Ha7
15	9606.ENSP00000251645	0.520	Keratin, type I cuticular Ha1
16	9606.ENSP00000007735	0.518	Keratin, type I cuticular Ha3-I
17	9606.ENSP00000377558	0.517	Keratin, type I cuticular Ha5
18	9606.ENSP00000225899	0.513	Keratin, type I cuticular Ha2
19	9606.ENSP00000251646	0.513	Keratin, type I cuticular Ha3-II
20	9606.ENSP00000329165	0.511	Keratin, type I cuticular Ha6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.675	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0032502	0.519	developmental process
GO:0071840	0.482	cellular component organization or biogenesis
GO:0016043	0.426	cellular component organization
GO:0048856	0.338	anatomical structure development
GO:0065007	0.316	biological regulation
GO:0050794	0.309	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.983	organelle
GO:0005576	0.899	extracellular region
GO:0043229	0.828	intracellular organelle
GO:0043227	0.768	membrane-bounded organelle
GO:0043228	0.611	non-membrane-bounded organelle
GO:0043232	0.591	intracellular non-membrane-bounded organelle
GO:0043230	0.567	extracellular organelle
GO:0005615	0.493	extracellular space
GO:0005856	0.467	cytoskeleton
GO:0099513	0.346	polymeric cytoskeletal fiber
GO:0045111	0.338	intermediate filament cytoskeleton
GO:0005882	0.326	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]