StarFunc result for job id Q9C091

User Input

>input (1923 residues)
MGNSYAGQLKSARFEEALHNSIEASLRCSSVVPRPIFSQLYLDPDQHPFSSADVKPKVED
LDKDLVNRYTQNGSLDFSNNLTVNEMEDDEDDEEMSDSNSPPIPYSQKPAPEGSCTTDGF
CQAGKDLRLVSLCMEQIDIPAGFLLVGAKSPNLPEHILVCAVDKRFLPDDHGKNALLGFS
GNCIGCGERGFRYFTEFSNHINLKLTTQPKKQKHLKYYLVRSSQGVLSKGPLICWKECRS
RQSSASCHSIKPSSSVSSTVTPENGTTNGYKSGFTQTDAANGNSSHGGKGSASSSTPAHT
GNYSLSPRPSYASGDQATMFISGPPKKRHRGWYPGSPLPQPGLVVPVPTVRPLSRTEPLL
SAPVPQTPLTGILQPRPIPAGETVIVPENLLSNSGVRPVILIGYGTLPYFYGNVGDIVVS
PLLVNCYKIPQLENKDLEKLGLTGSQFLSVENMILLTIQYLVRLGPDQVPLREEFEQIML
KAMQEFTLRERALQIGAQCVPVSPGQLPWLARLIASVSQDLVHVVVTQNSLAEGISETLR
TLSEMRHYQRLPDYVVVICASKIRGNEFCVVVLGQHQSRALAESMLTTSEFLKEISYELI
TGKVSFLASHFKTTSLGDDLDKLLEKMQQRRGDSVVTPFDGDLNECVSPQEAAAMIPTQN
LDLDNETFHIYQPQLTVARKLLSQVCAIADSGSQSLDLGHFSKVDFIIIVPRSEVLVQQT
LQRIRQSGVLVDLGLEENGTAHQRAEKYVVRLDNEIQTKFEVFMRRVKQNPYTLFVLVHD
NSHVELTSVISGSLSHSEPSHGLADRVINCREVLEAFNLLVLQVSSFPYTLQTQQSRISS
SNEVHWIQLDTGEDVGCEEKLYFGLSEYSKSLQWGITSPLLRCDETFEKMVNTLLERYPR
LHSMVVRCYLLIQQYSEALMALTTMASLRDHSTPETLSIMDDLISSPGKNKSGRGHMLII
RVPSVQLAMLAKERLQEVRDKLGLQYRFEIILGNPATELSVATHFVARLKSWRGNEPEEW
IPRTYQDLDGLPCIVILTGKDPLGETFPRSLKYCDLRLIDSSYLTRTALEQEVGLACCYV
SKEVIRGPTVALDLSGKEQERAAVSENDSDELLIDLERPQSNSSAVTGTSGSIMENGVSS
SSTADKSQKQSLTPSFQSPATSLGLDEGVSASSAGAGAGETLKQECDSLGPQMASSTTSK
PSSSSSGPRTLPWPGQPIRGCRGPQAALPPVVILSKAAYSLLGSQKSGKLPSSSSLLPHA
DVAWVSSLRPLLNKDMSSEEQSLYYRQWTLARQHHADYSNQLDPASGTRNFHPRRLLLTG
PPQVGKTGSYLQFLRILFRMLIRLLEVDVYDEEEINTDHNESSEVSQSEGEPWPDIESFS
KMPFDVSVHDPKYSLMSLVYTEKLAGVKQEVIKESKVEEPRKRETVSIMLTKYAAYNTFH
HCEQCRQYMDFTSASQMSDSTLHAFTFSSSMLGEEVQLYFIIPKSKESHFVFSKQGKHLE
SMRLPLVSDKNLNAVKSPIFTPSSGRHEHGLLNLFHAMEGISHLHLLVVKEYEMPLYRKY
WPNHIMLVLPGMFNNAGVGAARFLIKELSYHNLELERNRLEELGIKRQCVWPFIVMMDDS
CVLWNIHSVQEPSSQPMEVGVSSKNVSLKTVLQHIEATPKIVHYAILGIQKWSSKLTSQS
LKAPFSRCHVHDFILLNTDLTQNVQYDFNRYFCEDADFNLRTNSSGLLICRFNNFSLMKK
HVQVGGQRDFIIKPKIMVSESLAPILPLQYICAPDSEHTLLAAPAQFLLEKFLQHASYKL
FPKAIHNFRSPVLAIDCYLNIGPEVAICYISSRPHSSNVNCEGVFFSGLLLYLCDSFVGA
DLKKFKFLKGATLCVICQDRSSLRQTIVRLELEDEWQFRLRDEFQTANSSDDKPLYFLTG
RHV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C091	1.000	1.000	0.000	1923	1.000	1.000	Q9C091.pdb.gz	GRB1L_HUMAN GREB1-like protein OS=Homo sapiens OX=9606 GN=GREB1L PE=1 SV=2
2	PDB:7v6cA	0.079	0.093	4.909E-4	1540	0.033	0.041	7v6cA.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
3	PDB:6fxrA	0.075	0.187	1.390E-3	700	0.012	0.034	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
4	PDB:5vheA	0.078	0.138	1.803E-3	871	0.026	0.057	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
5	AFDB:Q54Q16	0.115	0.115	5.347E-3	1917	0.073	0.073	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
6	PDB:5aorA	0.090	0.148	1.604E-2	1009	0.036	0.068	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.
7	PDB:6qw65B	0.076	0.074	1.689E-2	2001	0.031	0.029	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
8	PDB:7ln6F	0.064	0.131	2.080E-2	714	0.029	0.078	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
9	AFDB:Q57WC1	0.048	0.059	2.179E-2	1387	0.092	0.128	Q57WC1.pdb.gz	Q57WC1_TRYB2 Ancestral coatomer element 1 Sec16/Sec31 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.28C22.610 PE=3 SV=1
10	PDB:6opcF	0.058	0.128	2.562E-2	681	0.044	0.123	6opcF.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
11	PDB:5dcaA	0.071	0.070	3.323E-2	1948	0.042	0.041	5dcaA.pdb.gz
12	PDB:1fc4A	0.045	0.151	3.501E-2	401	0.015	0.072	1fc4A.pdb.gz	Three-dimensional structure of 2-amino-3-ketobutyrate CoA ligase from Escherichia coli complexed with a PLP-substrate intermediate: inferred reaction mechanism.
13	PDB:7k0mA	0.052	0.146	3.885E-2	464	0.020	0.082	7k0mA.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
14	AFDB:Q9U7E0	0.049	0.064	6.500E-2	1359	0.067	0.095	Q9U7E0.pdb.gz	ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans OX=6239 GN=xnp-1 PE=1 SV=1
15	AFDB:F4IAE9	0.051	0.073	9.356E-2	1210	0.098	0.155	F4IAE9.pdb.gz	Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana OX=3702 GN=At1g05910 PE=2 SV=1
16	AFDB:Q08562	0.049	0.054	1.419E-1	1619	0.062	0.074	Q08562.pdb.gz	ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULS1 PE=1 SV=1
17	AFDB:Q6JPI3	0.038	0.035	1.419E-1	2207	0.112	0.098	Q6JPI3.pdb.gz	MD13L_MOUSE Mediator of RNA polymerase II transcription subunit 13-like OS=Mus musculus OX=10090 GN=Med13l PE=1 SV=2
18	AFDB:Q9GQN5	0.056	0.074	1.747E-1	1311	0.070	0.103	Q9GQN5.pdb.gz	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
19	AFDB:Q09XV5	0.109	0.087	1.840E-1	2582	0.082	0.061	Q09XV5.pdb.gz	CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus OX=10090 GN=Chd8 PE=1 SV=1
20	AFDB:Q9SE97	0.042	0.058	2.266E-1	1051	0.071	0.129	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JKP6	0.0	2341	1942	0.637	0.631	GRB1L_DANRE GREB1-like protein OS=Danio rerio OX=7955 GN=greb1l PE=1 SV=2
2	B9EJV3	0.0	3542	1913	0.902	0.906	GRB1L_MOUSE GREB1-like protein OS=Mus musculus OX=10090 GN=Greb1l PE=2 SV=1
3	F1QAG4	0.0	875	1840	0.264	0.276	F1QAG4_DANRE Growth-regulating estrogen receptor-binding 1 OS=Danio rerio OX=7955 GN=greb1 PE=1 SV=2
4	Q4ZG55	0.0	949	1949	0.278	0.274	GREB1_HUMAN Protein GREB1 OS=Homo sapiens OX=9606 GN=GREB1 PE=2 SV=1
5	Q9C091	0.0	3974	1923	1.000	1.000	GRB1L_HUMAN GREB1-like protein OS=Homo sapiens OX=9606 GN=GREB1L PE=1 SV=2
6	A0A024R693	0.018	41.6	250	0.021	0.164	A0A024R693_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
7	P17931	0.018	41.6	250	0.021	0.164	LEG3_HUMAN Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5
8	P35249	0.022	41.6	363	0.022	0.118	RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=2
9	C9JZI1	0.023	41.6	336	0.022	0.128	C9JZI1_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=1
10	G3V3R6	0.026	40.8	233	0.021	0.176	G3V3R6_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
11	Q99J62	0.065	40.0	364	0.022	0.115	RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus OX=10090 GN=Rfc4 PE=1 SV=1
12	Q9VX15	0.99	36.6	353	0.014	0.076	Q9VX15_DROME LD35209p OS=Drosophila melanogaster OX=7227 GN=Rfc37 PE=1 SV=2
13	Q7Z5P9	2.2	35.8	8384	0.019	0.004	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
14	Q9H1R3	2.2	35.4	596	0.021	0.067	MYLK2_HUMAN Myosin light chain kinase 2, skeletal/cardiac muscle OS=Homo sapiens OX=9606 GN=MYLK2 PE=1 SV=3
15	P48422	3.7	34.7	513	0.019	0.072	C86A1_ARATH Cytochrome P450 86A1 OS=Arabidopsis thaliana OX=3702 GN=CYP86A1 PE=1 SV=2
16	P70211	4.8	34.7	1447	0.034	0.045	DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 GN=Dcc PE=1 SV=2
17	Q9WUK4	4.9	34.3	349	0.015	0.083	RFC2_MOUSE Replication factor C subunit 2 OS=Mus musculus OX=10090 GN=Rfc2 PE=1 SV=1
18	P18433	5.5	34.3	802	0.011	0.027	PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3
19	P53016	7.3	33.5	334	0.018	0.105	RFC4_CAEEL Replication factor C subunit 4 OS=Caenorhabditis elegans OX=6239 GN=rfc-4 PE=1 SV=1
20	Q7ZYP6	8.4	33.9	626	0.014	0.043	MCMBP_XENLA Mini-chromosome maintenance complex-binding protein OS=Xenopus laevis OX=8355 GN=mcmbp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15782 GREB1	0	1771.1	GREB1 N-terminal region
2	PF20267 GREB1_C	0	1301.5	GREB1 C-terminal region
3	PF04078 Rcd1	37	15.1	Cell differentiation family, Rcd1-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464162

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410309	0.702	Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
2	9606.ENSP00000454748	0.697	Leucine-rich repeat-containing protein 9
3	9606.ENSP00000289119	0.670	Phospholipase ABHD3
4	9606.ENSP00000359404	0.643	Involved in clathrin-mediated endocytosis at the synapse. Plays a role in neuronal development and in synaptic vesicle recycling in mature neurons, a process required for normal synaptic transmission.
5	9606.ENSP00000356064	0.596	Tubby-related protein 4
6	9606.ENSP00000381436	0.594	Transcription cofactor vestigial-like protein 3
7	9606.ENSP00000261537	0.584	E3 ubiquitin-protein ligase MIB1
8	9606.ENSP00000352606	0.546	Hyaluronan and proteoglycan link protein 3
9	9606.ENSP00000371548	0.543	Leucine rich repeat LGI family member 2
10	9606.ENSP00000364685	0.520	Microfibrillar-associated protein 2
11	9606.ENSP00000278550	0.519	Teneurin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.694	catalytic activity
GO:0097159	0.413	organic cyclic compound binding
GO:1901363	0.412	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0072001	0.910	renal system development
GO:0001822	0.853	kidney development
GO:0065007	0.464	biological regulation
GO:0009987	0.415	cellular process
GO:0050794	0.362	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005576	0.997	extracellular region
GO:0031982	0.986	vesicle
GO:0005615	0.981	extracellular space
GO:0070062	0.861	extracellular exosome
GO:0005737	0.748	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]