StarFunc result for job id Q9C093

User Input

>input (1822 residues)
MSEILCQWLNKELKVSRTVSPKSFAKAFSSGYLLGEVLHKFELQDDFSEFLDSRVSSAKL
NNFSRLEPTLNLLGVQFDQNVAHGIITEKPGVATKLLYQLYIALQKKKKSGLTGVEMQTM
QRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLER
FQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKE
AEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDDEYIKKIQKRLEED
AFAREQREKRRRKLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKE
VLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQA
RYEKHYSVCAEILDQIVDLSTKVADYRMLTNNLIPYKLMHDWKELFFNAKPIYEQASVKT
LPANPSREQLTELEKRDLLDTNDYEEYKNMVGEWALPEEMVDNLPPSNNCILGHILHRLA
EKSLPPRAESTTPELPSFAVKGCLLGKTLSGKTTILRSLQKDFPIQILSIDTLVQEAIQA
FHDNEKVSEVLPIQKNDEEDALPVLQEEIKESQDPQHVFSAGPVSDEVLPETEGETMLSA
NADKTPKAEEVKSSDSFLKLTTRAQLGAKSEQLLKKGKSIPDVLLVDIIVNAINEIPVNQ
DCILDGFPMTLNQAQLLEEALTGCNRNLTEVERKKAQKSTLAIDPATSKEIPLPSPAFDF
VILLDVSDTSSMSRMNDIIAEELSYKTAHEDISQRVAAENQDKDGDQNLRDQIQHRIIGF
LDNWPLLEQWFSEPENILIKINAEIDKESLCEKVKEILTTEIAKKKNKVEKKLEEKEAEK
KAAASLAELPLPTPPPAPPPEPEKEKEIHQSHVASKTPTAKGKPQSEAPHGKQESLQEGK
GKKGETALKRKGSPKGKSSGGKVPVKKSPADSTDTSPVAIVPQPPKPGSEEWVYVNEPVP
EEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDF
VAQWQADFNSLPDDLWDDEETKAELHQRVNDLRDRLWDICDARKEEAEQERLDIINESWL
QDTLGMTMNHFFSLMQAELNRFQDTKRLLQDYYWGMESKIPVEDNKRFTRIPLVQLDSKD
NSESQLRIPLVPRISISLETVTPKPKTKSVLKGKMDNSLENVESNFEADEKLVMDTWQQA
SLAVSHMVAAEIHQRLMEEEKENQPADPKEKSPQMGANKKVKKEPPKKKQEDKKPKGKSP
PMAEATPVIVTTEEIAEIKRKNELRVKIKEEHLAALQFEEIATQFRLELIKTKALALLED
LVTKVVDVYKLMEKWLGERYLNEMASTEKLTDVARYHIETSTKIQNELYLSQEDFFINGN
IKVFPDPPPSIRPPPVEKEEDGTLTIEQLDSLRDQFLDMAPKGIIGNKAFTDILIDLVTL
NLGTNNFPSNWMHLTQPELQELTSLLTVNSEFVDWRKFLLVTSMPWPIPLEEELLETLQK
FKAVDKEQLGTITFEQYMQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLFADYE
KDPPQLDYTQMLLYFACHPDTVEGVYRALSVAVGTHVFQQVKASIPSAEKTSSTDAGPAE
EFPEPEENAAREERKLKDDTEKREQKDEEIPENANNEKMSMETLLKVFKGGSEAQDSNRF
ASHLKIENIYAEGFIKTFQDLGAKNLEPIEVAVLLKHPFIQDLISNYSDYKFPDIKIILQ
RSEHVQGSDGERSPSRHTEEKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C9J3	0.626	0.658	0.000	1724	0.699	0.738	Q8C9J3.pdb.gz	SPEF2_MOUSE Sperm flagellar protein 2 OS=Mus musculus OX=10090 GN=Spef2 PE=1 SV=3
2	AFDB:Q9C093	1.000	1.000	0.000	1822	1.000	1.000	Q9C093.pdb.gz	SPEF2_HUMAN Sperm flagellar protein 2 OS=Homo sapiens OX=9606 GN=SPEF2 PE=1 SV=2
3	PDB:7n6g6A	0.317	0.363	1.053E-37	1558	0.178	0.209	7n6g6A.pdb.gz	Cryo-EM structure of an active central apparatus.
4	PDB:7sqcC2	0.375	0.445	3.142E-35	1498	0.191	0.232	7sqcC2.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
5	PDB:1ukyA	0.087	0.686	3.280E-5	196	0.021	0.199	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.
6	PDB:2c95A	0.089	0.699	7.496E-5	195	0.020	0.190	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
7	PDB:2cdnA	0.088	0.730	1.640E-4	186	0.025	0.242	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
8	PDB:2c9yA	0.090	0.682	2.887E-4	218	0.025	0.206	2c9yA.pdb.gz	Structure of Human Adenylate Kinase 2
9	PDB:1qf9A	0.086	0.683	5.791E-4	194	0.024	0.222	1qf9A.pdb.gz	pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog.
10	PDB:1dvrA	0.091	0.673	1.794E-3	220	0.024	0.195	1dvrA.pdb.gz	Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP.
11	PDB:1tevA	0.090	0.739	2.330E-3	194	0.023	0.211	1tevA.pdb.gz
12	PDB:2ar7A	0.087	0.607	3.024E-3	221	0.024	0.195	2ar7A.pdb.gz
13	AFDB:X1WCJ5	0.041	0.058	2.106E-2	1226	0.105	0.157	X1WCJ5.pdb.gz	X1WCJ5_DANRE Liprin-alpha-3 isoform X1 OS=Danio rerio OX=7955 GN=ppfia3 PE=3 SV=1
14	AFDB:Q584H3	0.052	0.082	1.008E-1	1000	0.078	0.143	Q584H3.pdb.gz	Q584H3_TRYB2 Coiled-coil flagellar protein, move backward only 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.60 PE=4 SV=1
15	AFDB:Q3TVA9	0.062	0.088	1.428E-1	1136	0.092	0.147	Q3TVA9.pdb.gz	CC136_MOUSE Coiled-coil domain-containing protein 136 OS=Mus musculus OX=10090 GN=Ccdc136 PE=1 SV=2
16	AFDB:Q9JLH5	0.051	0.050	2.113E-1	1903	0.127	0.122	Q9JLH5.pdb.gz	CK5P2_RAT CDK5 regulatory subunit-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cdk5rap2 PE=1 SV=2
17	AFDB:Q8IUG5	0.064	0.050	2.305E-1	2567	0.085	0.060	Q8IUG5.pdb.gz	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
18	AFDB:E7ESP9	0.048	0.087	2.626E-1	877	0.061	0.127	E7ESP9.pdb.gz	E7ESP9_HUMAN Neurofilament medium chain OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=1
19	AFDB:Q96M63	0.057	0.124	3.409E-1	670	0.058	0.157	Q96M63.pdb.gz	ODAD1_HUMAN Outer dynein arm-docking complex subunit 1 OS=Homo sapiens OX=9606 GN=ODAD1 PE=1 SV=3
20	AFDB:A0A0R4J7R2	0.043	0.035	3.560E-1	2454	0.094	0.070	A0A0R4J7R2.pdb.gz	A0A0R4J7R2_DANRE Myosin XVIIIAa OS=Danio rerio OX=7955 GN=myo18aa PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C9J3	0.0	2433	1724	0.701	0.741	SPEF2_MOUSE Sperm flagellar protein 2 OS=Mus musculus OX=10090 GN=Spef2 PE=1 SV=3
2	Q9C093	0.0	3736	1822	1.000	1.000	SPEF2_HUMAN Sperm flagellar protein 2 OS=Homo sapiens OX=9606 GN=SPEF2 PE=1 SV=2
3	Q6J4H1	5.38e-42	172	1929	0.125	0.118	Q6J4H1_CHLRE Central pair complex 1 OS=Chlamydomonas reinhardtii OX=3055 GN=CPC1 PE=1 SV=1
4	O82514	2.67e-05	50.1	246	0.015	0.110	KAD4_ARATH Adenylate kinase 4 OS=Arabidopsis thaliana OX=3702 GN=ADK1 PE=1 SV=2
5	Q9FK35	2.38e-04	47.0	248	0.014	0.101	KAD3_ARATH Adenylate kinase 3 OS=Arabidopsis thaliana OX=3702 GN=ADK2 PE=1 SV=1
6	Q08479	6.68e-04	45.8	241	0.013	0.100	KAD3_ORYSJ Adenylate kinase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=ADK-A PE=2 SV=1
7	Q08480	6.97e-04	45.8	243	0.013	0.099	KAD4_ORYSJ Adenylate kinase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=ADK-B PE=2 SV=1
8	A0A2R9YJL3	0.008	43.9	1762	0.011	0.011	A0A2R9YJL3_DANRE Cilia- and flagella-associated protein 206 OS=Danio rerio OX=7955 GN=si:ch211-199m3.4 PE=3 SV=1
9	Q9VGU6	0.010	42.0	216	0.011	0.093	Q9VGU6_DROME GTP:AMP phosphotransferase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Ak3 PE=1 SV=1
10	Q8K3V1	0.011	42.4	295	0.022	0.136	SPAT4_MOUSE Spermatogenesis-associated protein 4 OS=Mus musculus OX=10090 GN=Spata4 PE=1 SV=1
11	Q9U915	0.011	42.0	240	0.013	0.096	KAD2_DROME Adenylate kinase OS=Drosophila melanogaster OX=7227 GN=Adk2 PE=1 SV=1
12	Q5B2V8	0.034	40.4	259	0.017	0.120	KAD2_EMENI Adenylate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=adk1 PE=3 SV=1
13	Q1L8L9	0.036	40.4	241	0.010	0.079	KAD2_DANRE Adenylate kinase 2, mitochondrial OS=Danio rerio OX=7955 GN=ak2 PE=2 SV=1
14	Q38EC4	0.048	39.7	200	0.012	0.105	Q38EC4_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0350 PE=3 SV=1
15	Q38BZ2	0.11	38.9	222	0.010	0.081	Q38BZ2_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5150 PE=3 SV=1
16	Q9WUR9	0.11	38.9	223	0.016	0.130	KAD4_MOUSE Adenylate kinase 4, mitochondrial OS=Mus musculus OX=10090 GN=Ak4 PE=1 SV=1
17	P07170	0.13	38.5	222	0.010	0.086	KAD2_YEAST Adenylate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK1 PE=1 SV=2
18	Q9WUS0	0.13	38.5	223	0.014	0.117	KAD4_RAT Adenylate kinase 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ak4 PE=2 SV=1
19	Q8NEY3	0.21	38.5	305	0.015	0.092	SPAT4_HUMAN Spermatogenesis-associated protein 4 OS=Homo sapiens OX=9606 GN=SPATA4 PE=1 SV=1
20	P26364	0.27	37.4	225	0.016	0.133	KAD3_YEAST GTP:AMP phosphotransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13207 AAA_17	42	16.0	AAA domain
2	PF00406 ADK	8.2e-05	34.2	Adenylate kinase
3	PF06294 CH_2	5.9e-18	76.0	CH-like domain in sperm protein
4	PF17213 Hydin_ADK	6.8e+02	11.7	Hydin Adenylate kinase-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348314

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286621	0.915	Adenosine kinase
2	9606.ENSP00000393222	0.870	Cilia- and flagella-associated protein 221
3	9606.ENSP00000337804	0.867	Sperm-associated antigen 17
4	9606.ENSP00000431759	0.769	Cilia- and flagella-associated protein 54
5	9606.ENSP00000359990	0.715	Leucine-rich repeat-containing protein 40
6	9606.ENSP00000349568	0.710	Cilia and flagella associated protein 43
7	9606.ENSP00000365811	0.706	Sperm-associated antigen 6
8	9606.ENSP00000377197	0.689	Hydrocephalus-inducing protein homolog
9	9606.ENSP00000482954	0.680	Prolactin receptor
10	9606.ENSP00000405708	0.674	Coiled-coil domain-containing protein 39
11	9606.ENSP00000273390	0.642	Cilia- and flagella-associated protein 91
12	9606.ENSP00000464443	0.639	Intraflagellar transport protein 20 homolog
13	9606.ENSP00000398273	0.632	Transcription factor SOX-5
14	9606.ENSP00000361646	0.628	Zinc finger MYND-type containing 12
15	9606.ENSP00000373948	0.616	Cilia- and flagella-associated protein 69
16	9606.ENSP00000229554	0.605	Radial spoke head protein 4 homolog A
17	9606.ENSP00000380679	0.598	Coiled-coil domain-containing protein 40
18	9606.ENSP00000385158	0.596	Protein FAM161A
19	9606.ENSP00000393316	0.596	Thioredoxin-related transmembrane protein 1
20	9606.ENSP00000337946	0.591	Parkin coregulated gene protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.420	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0071840	0.960	cellular component organization or biogenesis
GO:0016043	0.943	cellular component organization
GO:0044085	0.923	cellular component biogenesis
GO:0032501	0.908	multicellular organismal process
GO:0032502	0.907	developmental process
GO:0022607	0.906	cellular component assembly
GO:0048856	0.898	anatomical structure development
GO:0006996	0.862	organelle organization
GO:0003341	0.839	cilium movement
GO:0035082	0.838	axoneme assembly
GO:0007288	0.811	sperm axoneme assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036126	0.999	sperm flagellum
GO:0043229	0.958	intracellular organelle
GO:0005737	0.921	cytoplasm
GO:0043232	0.864	intracellular non-membrane-bounded organelle
GO:0005856	0.619	cytoskeleton
GO:0043231	0.576	intracellular membrane-bounded organelle
GO:0005829	0.477	cytosol
GO:0015630	0.360	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]