StarFunc result for job id Q9C099

User Input

>input (1032 residues)
MEAAAAVVAAEAEVENEDGDSSCGDVCFMDKGLQSISELSLDSTLHAVNLHCNNISKIEA
IDHIWNLQHLDLSSNQISRIEGLNTLTKLCTLNLSCNLITKVEGLEELINLTRLNVSYNH
IDDLSGLIPLHGIKHKLRYIDLHSNRIDSIHHLLQCMVGLHFLTNLILEKDGDDNPVCRL
PGYRAVILQTLPQLRILDCKNIFGEPVNLTEINSSQLQCLEGLLDNLVSSDSPLNISEDE
IIDRMPVITAPIDELVPLEQFASTPSDAVLTSFMSVCQSSEPEKNNHENDLQNEIKLQKL
DDQILQLLNETSNSIDNVLEKDPRPKRDTDITSESDYGNRKECNRKVPRRSKIPYDAKTI
QTIKHHNKNYNSFVSCNRKMKPPYLKELYVSSSLANCPMLQESEKPKTEIIKVDQSHSED
NTYQSLVEQLDQEREKRWRAEQAENKLMDYIDELHKHANEKEDIHSLALLTTDRLKEIIF
RERNSKGQLEVMVHKLQNEIKKLTVELMKAKDQQEDHLKHLRTLEKTLEKMERQKRQQQA
AQIRLIQEVELKASAADREIYLLRTSLHREREQAQQLHQLLALKEQEHRKELETREFFTD
ADFQDALAKEIAKEEKKHEQMIKEYQEKIDVLSQQYMDLENEFRIALTVEARRFQDVKDG
FENVATELAKSKHALIWAQRKENESSSLIKDLTCMVKEQKTKLAEVSKLKQETAANLQNQ
INTLEILIEDDKQKSIQIELLKHEKVQLISELAAKESLIFGLRTERKVWGHELAQQGSSL
AQNRGKLEAQIESLSRENECLRKTNESDSDALRIKCKIIDDQTETIRKLKDCLQEKDEHI
KRLQEKITEIEKCTQEQLDEKSSQLDEVLEKLERHNERKEKLKQQLKGKEVELEEIRKAY
STLNRKWHDKGELLCHLETQVKEVKEKFENKEKKLKAERDKSIELQKNAMEKLHSMDDAF
KRQVDAIVEAHQAEIAQLANEKQKCIDSANLKVHQIEKEMRELLEETCKNKKTMEAKIKQ
LAFALNEIQQDM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C099	1.000	1.000	0.000	1032	1.000	1.000	Q9C099.pdb.gz	LRCC1_HUMAN Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRCC1 PE=1 SV=2
2	AFDB:Q387G4	0.172	0.187	5.551E-17	948	0.163	0.177	Q387G4.pdb.gz	Q387G4_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0280 PE=4 SV=1
3	PDB:6hkwA	0.147	0.449	1.378E-13	306	0.057	0.193	6hkwA.pdb.gz
4	AFDB:Q7ZV84	0.160	0.294	1.401E-13	555	0.086	0.160	Q7ZV84.pdb.gz	DAAF1_DANRE Dynein axonemal assembly factor 1 OS=Danio rerio OX=7955 GN=dnaaf1 PE=2 SV=2
5	AFDB:A2AL36	0.151	0.068	1.113E-10	2334	0.202	0.089	A2AL36.pdb.gz	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
6	AFDB:Q9P209	0.100	0.153	1.113E-10	647	0.115	0.184	Q9P209.pdb.gz	CEP72_HUMAN Centrosomal protein of 72 kDa OS=Homo sapiens OX=9606 GN=CEP72 PE=1 SV=2
7	AFDB:Q9D3R3	0.105	0.148	3.109E-10	646	0.110	0.176	Q9D3R3.pdb.gz	CEP72_MOUSE Centrosomal protein of 72 kDa OS=Mus musculus OX=10090 GN=Cep72 PE=1 SV=3
8	AFDB:Q7Z7A1	0.157	0.073	2.153E-8	2325	0.172	0.077	Q7Z7A1.pdb.gz	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
9	PDB:7a5pW	0.115	0.635	6.725E-8	174	0.041	0.241	7a5pW.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
10	PDB:7tvfD	0.132	0.251	7.647E-8	515	0.043	0.085	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
11	PDB:7p5vB	0.140	0.195	3.140E-7	732	0.050	0.071	7p5vB.pdb.gz
12	PDB:1m9sA	0.139	0.269	5.968E-7	523	0.045	0.088	1m9sA.pdb.gz
13	PDB:3jb9j	0.111	0.653	7.236E-7	160	0.037	0.237	3jb9j.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
14	PDB:6g90W	0.116	0.661	9.354E-7	170	0.035	0.212	6g90W.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
15	PDB:6gffI	0.116	0.205	9.354E-7	551	0.047	0.087	6gffI.pdb.gz
16	PDB:1dceA	0.103	0.178	1.778E-6	567	0.028	0.051	1dceA.pdb.gz	Crystal structure of Rab geranylgeranyltransferase at 2.0 A resolution.
17	PDB:6xzqG	0.116	0.689	1.778E-6	158	0.032	0.209	6xzqG.pdb.gz	Host ANP32A mediates the assembly of the influenza virus replicase.
18	AFDB:Q6ZQ06	0.096	0.075	7.423E-6	1403	0.143	0.105	Q6ZQ06.pdb.gz	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
19	AFDB:Q9VTN6	0.084	0.092	8.999E-6	928	0.130	0.144	Q9VTN6.pdb.gz	Q9VTN6_DROME Twitchy OS=Drosophila melanogaster OX=7227 GN=twy PE=4 SV=1
20	AFDB:O94488	0.108	0.101	1.241E-5	1115	0.127	0.117	O94488.pdb.gz	MBO1_SCHPO Microtubule organizer protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mbo1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C099	0.0	2086	1032	1.000	1.000	LRCC1_HUMAN Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRCC1 PE=1 SV=2
2	Q15435	1.44e-14	79.0	360	0.061	0.175	PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1
3	A8IVX2	2.36e-14	79.3	524	0.056	0.111	DRC3_CHLRE Dynein regulatory complex subunit 3 OS=Chlamydomonas reinhardtii OX=3055 GN=DRC3 PE=1 SV=1
4	Q3UM45	1.61e-13	75.5	361	0.055	0.158	PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2
5	A2AL36	2.87e-13	77.0	2334	0.055	0.024	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
6	Q8INT5	5.55e-13	76.3	1483	0.062	0.043	DAAF1_DROME Dynein axonemal assembly factor 1 homolog OS=Drosophila melanogaster OX=7227 GN=dtr PE=2 SV=2
7	Q7Z7A1	1.21e-12	75.1	2325	0.057	0.025	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
8	Q7ZV84	4.41e-12	72.4	555	0.054	0.101	DAAF1_DANRE Dynein axonemal assembly factor 1 OS=Danio rerio OX=7955 GN=dnaaf1 PE=2 SV=2
9	Q91YK0	1.17e-11	71.2	686	0.057	0.086	LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus OX=10090 GN=Lrrc49 PE=1 SV=1
10	Q582Q8	1.19e-11	70.1	383	0.055	0.149	Q582Q8_TRYB2 U2A'/phosphoprotein 32 family A C-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.370 PE=4 SV=1
11	Q9NJE9	1.57e-11	69.7	383	0.055	0.149	DAA11_TRYBB Dynein axonemal assembly factor 11 OS=Trypanosoma brucei brucei OX=5702 GN=dnaaf11 PE=3 SV=1
12	Q387G4	1.69e-11	70.9	948	0.047	0.051	Q387G4_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0280 PE=4 SV=1
13	Q8IUZ0	2.52e-11	70.1	686	0.055	0.083	LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens OX=9606 GN=LRRC49 PE=1 SV=2
14	Q9H069	9.35e-11	68.2	523	0.049	0.098	DRC3_HUMAN Dynein regulatory complex subunit 3 OS=Homo sapiens OX=9606 GN=DRC3 PE=1 SV=2
15	Q9VEK8	1.09e-10	66.6	326	0.047	0.150	Q9VEK8_DROME GH07711p OS=Drosophila melanogaster OX=7227 GN=sds22 PE=1 SV=1
16	Q9U3W5	1.30e-10	66.2	326	0.047	0.150	Q9U3W5_DROME Putative mitotic protein phosphatase 1 regulator OS=Drosophila melanogaster OX=7227 GN=sds22 PE=2 SV=1
17	Q382D9	2.22e-10	66.6	440	0.056	0.132	Q382D9_TRYB2 Leucine-rich repeat-containing protein ODA7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5550 PE=4 SV=1
18	A0A1L8G016	1.35e-09	63.9	469	0.048	0.107	DAA11_XENLA Dynein axonemal assembly factor 11 OS=Xenopus laevis OX=8355 GN=dnaaf11 PE=3 SV=1
19	Q9VL65	1.57e-09	64.3	566	0.047	0.085	Q9VL65_DROME TbCMF46 OS=Drosophila melanogaster OX=7227 GN=TbCMF46 PE=4 SV=2
20	A0A140VJN4	3.48e-09	63.2	725	0.057	0.081	A0A140VJN4_HUMAN Dynein axonemal assembly factor 1 OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	2.9e+02	13.5	Leucine Rich Repeat
2	PF12799 LRR_4	2.8e-09	48.3	Leucine Rich repeats (2 copies)
3	PF13516 LRR_6	20	16.6	Leucine Rich repeat
4	PF13855 LRR_8	1.1e-06	39.6	Leucine rich repeat
5	PF14580 LRR_9	5e-06	37.7	Leucine-rich repeat
6	PF18389 TrmO_C	1.2e+02	14.1	TrmO C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353538

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377668	0.727	Sulfite oxidase, mitochondrial
2	9606.ENSP00000417003	0.703	Involved in skeletal muscle differentiation. May act as a scaffold protein for AKT1 during muscle differentiation.
3	9606.ENSP00000257287	0.691	Centrosomal protein of 135 kDa
4	9606.ENSP00000430128	0.671	RNA-binding Raly-like protein
5	9606.ENSP00000418751	0.668	BTB/POZ domain-containing protein 9
6	9606.ENSP00000297524	0.633	Solute carrier family 7 member 13
7	9606.ENSP00000287482	0.615	Spindle assembly abnormal protein 6 homolog
8	9606.ENSP00000252530	0.606	Protein FAM98C
9	9606.ENSP00000395012	0.601	Kelch-like protein 24
10	9606.ENSP00000371308	0.559	Centromere protein J
11	9606.ENSP00000478298	0.518	Signal peptide peptidase-like 2B
12	9606.ENSP00000370021	0.516	Centlein
13	9606.ENSP00000278935	0.515	Centrosomal protein of 164 kDa
14	9606.ENSP00000296292	0.514	Protein RFT1 homolog
15	9606.ENSP00000246194	0.507	RNA-binding protein Raly
16	9606.ENSP00000404122	0.507	Intraflagellar transport protein 74 homolog
17	9606.ENSP00000379911	0.500	Centromere protein K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050789	0.865	regulation of biological process
GO:0071840	0.864	cellular component organization or biogenesis
GO:0050794	0.849	regulation of cellular process
GO:0016043	0.832	cellular component organization
GO:0006996	0.537	organelle organization
GO:0007017	0.338	microtubule-based process
GO:0022607	0.330	cellular component assembly
GO:0000226	0.300	microtubule cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0005737	0.609	cytoplasm
GO:0043227	0.590	membrane-bounded organelle
GO:0043231	0.454	intracellular membrane-bounded organelle
GO:0005814	0.335	centriole

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]