StarFunc result for job id Q9C0A0

User Input

>input (1308 residues)
MGSVTGAVLKTLLLLSTQNWNRVEAGNSYDCDDPLVSALPQASFSSSSELSSSHGPGFAR
LNRRDGAGGWSPLVSNKYQWLQIDLGERMEVTAVATQGGYGSSNWVTSYLLMFSDSGWNW
KQYRQEDSIWGFSGNANADSVVYYRLQPSIKARFLRFIPLEWNPKGRIGMRIEVFGCAYR
SEVVDLDGKSSLLYRFDQKSLSPIKDIISLKFKTMQSDGILLHREGPNGDHITLQLRRAR
LFLLINSGEAKLPSTSTLVNLTLGSLLDDQHWHSVLIQRLGKQVNFTVDEHRHHFHARGE
FNLMNLDYEISFGGIPAPGKSVSFPHRNFHGCLENLYYNGVDIIDLAKQQKPQIIAMGNV
SFSCSQPQSMPVTFLSSRSYLALPDFSGEEEVSATFQFRTWNKAGLLLFSELQLISGGIL
LFLSDGKLKSNLYQPGKLPSDITAGVELNDGQWHSVSLSAKKNHLSVAVDGQMASAAPLL
GPEQIYSGGTYYFGGCPDKSFGSKCKSPLGGFQGCMRLISISGKVVDLISVQQGSLGNFS
DLQIDSCGISDRCLPNYCEHGGECSQSWSTFHCNCTNTGYRGATCHNSIYEQSCEAYKHR
GNTSGFYYIDSDGSGPLEPFLLYCNMTETAWTIIQHNGSDLTRVRNTNPENPYAGFFEYV
ASMEQLQATINRAEHCEQEFTYYCKKSRLVNKQDGTPLSWWVGRTNETQTYWGGSSPDLQ
KCTCGLEGNCIDSQYYCNCDADRNEWTNDTGLLAYKEHLPVTKIVITDTGRLHSEAAYKL
GPLLCQGDRSFWNSASFDTEASYLHFPTFHGELSADVSFFFKTTASSGVFLENLGIADFI
RIELRSPTVVTFSFDVGNGPFEISVQSPTHFNDNQWHHVRVERNMKEASLQVDQLTPKTQ
PAPADGHVLLQLNSQLFVGGTATRQRGFLGCIRSLQLNGMTLDLEERAQVTPEVQPGCRG
HCSSYGKLCRNGGKCRERPIGFFCDCTFSAYTGPFCSNEISAYFGSGSSVIYNFQENYLL
SKNSSSHAASFHGDMKLSREMIKFSFRTTRTPSLLLFVSSFYKEYLSVIIAKNGSLQIRY
KLNKYQEPDVVNFDFKNMADGQLHHIMINREEGVVFIEIDDNRRRQVHLSSGTEFSAVKS
LVLGRILEHSDVDQDTALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTES
SCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSAVIGGLIAVVIFILLCITAI
AVRIYQQKRLYKRSEAKRSENVDSAEAVLKSELNIQNAVNENQKEYFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PY62	0.879	0.893	0.000	1287	0.625	0.635	E9PY62.pdb.gz	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
2	AFDB:O54991	0.646	0.612	0.000	1385	0.372	0.352	O54991.pdb.gz	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
3	AFDB:Q94887	0.628	0.639	0.000	1284	0.301	0.307	Q94887.pdb.gz	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
4	AFDB:Q99P47	0.961	0.959	0.000	1310	0.864	0.863	Q99P47.pdb.gz	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
5	AFDB:Q9C0A0	1.000	1.000	0.000	1308	1.000	1.000	Q9C0A0.pdb.gz	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
6	AFDB:Q9CPW0	0.842	0.827	0.000	1332	0.482	0.474	Q9CPW0.pdb.gz	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
7	AFDB:M9PE65	0.322	0.222	2.027E-72	2179	0.216	0.130	M9PE65.pdb.gz	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
8	AFDB:Q19617	0.507	0.556	1.416E-71	1180	0.196	0.217	Q19617.pdb.gz	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
9	AFDB:Q6P9K9	0.172	0.146	4.116E-63	1571	0.200	0.166	Q6P9K9.pdb.gz	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
10	AFDB:Q9Y4C0	0.173	0.142	1.429E-61	1643	0.201	0.160	Q9Y4C0.pdb.gz	NRX3A_HUMAN Neurexin-3 OS=Homo sapiens OX=9606 GN=NRXN3 PE=1 SV=4
11	PDB:2vmeA	0.105	0.508	1.467E-7	256	0.043	0.219	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.
12	PDB:4bxsV	0.107	0.110	4.487E-7	1262	0.044	0.045	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
13	PDB:7kveB	0.108	0.103	7.294E-7	1374	0.045	0.043	7kveB.pdb.gz
14	PDB:6m5yA	0.088	0.356	2.125E-6	270	0.026	0.126	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
15	PDB:2w94A	0.106	0.512	4.404E-6	254	0.037	0.193	2w94A.pdb.gz	Discoidin I from Dictyostelium Discoideum and Interactions with Oligosaccharides: Specificity, Affinity, Crystal Structures and Comparison with Discoidin II.
16	PDB:4pbpB	0.108	0.577	5.616E-6	210	0.028	0.171	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
17	PDB:3jd6O	0.104	0.737	6.820E-6	167	0.036	0.281	3jd6O.pdb.gz
18	PDB:7zl1A	0.108	0.561	8.284E-6	215	0.025	0.153	7zl1A.pdb.gz
19	PDB:7m6aA	0.063	0.035	8.696E-6	4306	0.060	0.018	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
20	PDB:2a3wA	0.105	0.563	1.558E-5	204	0.019	0.123	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GH02	0.0	1267	1332	0.482	0.473	A0A8I6GH02_RAT Contactin associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cntnap2 PE=3 SV=1
2	D8WUA6	0.0	1265	1328	0.480	0.473	D8WUA6_TAEGU Contactin associated protein-like 2 OS=Taeniopygia guttata OX=59729 GN=CNTNAP2 PE=2 SV=1
3	E9PY62	0.0	1680	1287	0.630	0.640	E9PY62_MOUSE Contactin associated protein-like 3 OS=Mus musculus OX=10090 GN=Cntnap3 PE=1 SV=1
4	O54991	0.0	924	1385	0.363	0.343	CNTP1_MOUSE Contactin-associated protein 1 OS=Mus musculus OX=10090 GN=Cntnap1 PE=1 SV=2
5	P78357	0.0	935	1384	0.368	0.348	CNTP1_HUMAN Contactin-associated protein 1 OS=Homo sapiens OX=9606 GN=CNTNAP1 PE=1 SV=1
6	P97846	0.0	923	1381	0.365	0.345	CNTP1_RAT Contactin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Cntnap1 PE=1 SV=1
7	Q3URC6	0.0	658	510	0.245	0.627	Q3URC6_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Cntnap3 PE=2 SV=1
8	Q94887	0.0	624	1284	0.300	0.305	NRX4_DROME Neurexin-4 OS=Drosophila melanogaster OX=7227 GN=Nrx-IV PE=1 SV=2
9	Q99P47	0.0	2338	1310	0.865	0.863	CNTP4_MOUSE Contactin-associated protein-like 4 OS=Mus musculus OX=10090 GN=Cntnap4 PE=1 SV=2
10	Q9C0A0	0.0	2727	1308	1.000	1.000	CNTP4_HUMAN Contactin-associated protein-like 4 OS=Homo sapiens OX=9606 GN=CNTNAP4 PE=1 SV=3
11	Q9CPW0	0.0	1267	1332	0.482	0.473	CNTP2_MOUSE Contactin-associated protein-like 2 OS=Mus musculus OX=10090 GN=Cntnap2 PE=1 SV=2
12	Q9UHC6	0.0	1271	1331	0.482	0.474	CNTP2_HUMAN Contactin-associated protein-like 2 OS=Homo sapiens OX=9606 GN=CNTNAP2 PE=1 SV=1
13	M9PE65	5.08e-67	252	2179	0.192	0.115	AXO_DROME Axotactin OS=Drosophila melanogaster OX=7227 GN=axo PE=1 SV=1
14	Q19617	2.15e-54	210	1180	0.206	0.228	NLR1_CAEEL Neurexin like receptor 1 OS=Caenorhabditis elegans OX=6239 GN=nlr-1 PE=1 SV=3
15	Q9XYX0	3.33e-51	201	1685	0.182	0.141	Q9XYX0_DROME AXO OS=Drosophila melanogaster OX=7227 GN=axo PE=2 SV=1
16	A1XQX4	7.52e-34	144	1670	0.094	0.074	A1XQX4_DANRE Neurexin 2a alpha OS=Danio rerio OX=7955 GN=nrxn2a PE=2 SV=1
17	A0A0R4J2G7	2.25e-33	143	1495	0.089	0.078	A0A0R4J2G7_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
18	A0A1D5RMU6	2.86e-33	142	1499	0.089	0.078	A0A1D5RMU6_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
19	E7ERL8	4.78e-31	135	1507	0.089	0.078	E7ERL8_HUMAN Neurexin 1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1
20	Q9ULB1	6.04e-31	135	1477	0.089	0.079	NRX1A_HUMAN Neurexin-1 OS=Homo sapiens OX=9606 GN=NRXN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01410 COLFI	9.3	17.0	Fibrillar collagen C-terminal domain
2	PF00008 EGF	0.058	25.0	EGF-like domain
3	PF07974 EGF_2	31	16.4	EGF-like domain
4	PF00754 F5_F8_type_C	3.1e-24	96.9	F5/8 type C domain
5	PF00054 Laminin_G_1	4e-53	190.5	Laminin G domain
6	PF02210 Laminin_G_2	2.9e-87	301.0	Laminin G domain
7	PF13385 Laminin_G_3	2.5e-09	48.9	Concanavalin A-like lectin/glucanases superfamily

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479811

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000435637	0.943	Contactin-5
2	9606.ENSP00000265381	0.822	Amyloid-beta A4 precursor protein-binding family A member 1
3	9606.ENSP00000286827	0.774	T-lymphoma invasion and metastasis-inducing protein 1
4	9606.ENSP00000330633	0.740	Contactin-2
5	9606.ENSP00000380602	0.721	Contactin-4
6	9606.ENSP00000325929	0.718	Ligand of numb-protein X 2
7	9606.ENSP00000345259	0.715	Protein 4.1
8	9606.ENSP00000368314	0.677	Neuronal cell adhesion molecule
9	9606.ENSP00000407822	0.676	Contactin-6
10	9606.ENSP00000256509	0.660	Neural cell adhesion molecule L1-like protein
11	9606.ENSP00000367408	0.631	Peripheral plasma membrane protein CASK
12	9606.ENSP00000344786	0.608	Neurofascin
13	9606.ENSP00000446278	0.608	Leucine rich repeats and transmembrane domains 2
14	9606.ENSP00000351591	0.594	Neuroligin-3
15	9606.ENSP00000378464	0.593	Complexin-3
16	9606.ENSP00000447006	0.589	Contactin-1
17	9606.ENSP00000295452	0.586	Gamma-aminobutyric acid receptor subunit gamma-1
18	9606.ENSP00000405388	0.554	Carbonic anhydrase-related protein 10
19	9606.ENSP00000437188	0.549	T-lymphoma invasion and metastasis-inducing protein 2
20	9606.ENSP00000287907	0.540	5-hydroxytryptamine receptor 5A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.345	protein domain specific binding
GO:0030165	0.319	PDZ domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.995	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0032501	0.967	multicellular organismal process
GO:0048856	0.956	anatomical structure development
GO:0007275	0.953	multicellular organism development
GO:0048731	0.921	system development
GO:0007399	0.872	nervous system development
GO:0065008	0.824	regulation of biological quality
GO:0008283	0.765	cell population proliferation
GO:0023051	0.641	regulation of signaling
GO:0010646	0.641	regulation of cell communication
GO:0061351	0.551	neural precursor cell proliferation
GO:0032228	0.539	regulation of synaptic transmission, GABAergic
GO:0051128	0.389	regulation of cellular component organization
GO:0048869	0.363	cellular developmental process
GO:0050896	0.349	response to stimulus
GO:0071840	0.300	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0071944	0.995	cell periphery
GO:0043005	0.989	neuron projection
GO:0005886	0.988	plasma membrane
GO:0030054	0.967	cell junction
GO:0036477	0.964	somatodendritic compartment
GO:0045202	0.869	synapse
GO:0098793	0.758	presynapse
GO:0098590	0.750	plasma membrane region
GO:0005622	0.664	intracellular anatomical structure
GO:0097060	0.546	synaptic membrane
GO:0030424	0.528	axon
GO:0030425	0.524	dendrite
GO:0042734	0.396	presynaptic membrane
GO:0043025	0.387	neuronal cell body
GO:0098982	0.324	GABA-ergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]