StarFunc result for job id Q9C0A1

User Input

>input (2572 residues)
MATLNSASTTGTTPSPGHNAPSLPSDTFSSSTPSDPVTKDPPAASSTSENMRSSEPGGQL
LESGCGLVPPKEIGEPQEGPDCGHFPPNDPGVEKDKEQEEEEEGLPPMDLSNHLFFTAGG
EAYLVAKLSLPGGSELLLPKGFPWGEAGIKEEPSLPFLAYPPPSHLTALHIQHGFDPIQG
FSSSDQILSHDTSAPSPAACEERHGAFWSYQLAPNPPGDPKDGPMGNSGGNHVAVFWLCL
LCRLGFSKPQAFMDHTQSHGVKLTPAQYQGLSGSPAVLQEGDEGCKALISFLEPKLPARP
SSDIPLDNSSTVNMEANVAQTEDGPPEAEVQALILLDEEVMALSPPSPPTATWDPSPTQA
KESPVAAGEAGPDWFPEGQEEDGGLCPPLNQSSPTSKEGGTLPAPVGSPEDPSDPPQPYR
LADDYTPAPAAFQGLSLSSHMSLLHSRNSCKTLKCPKCNWHYKYQQTLDVHMREKHPESN
SHCSYCSAGGAHPRLARGESYNCGYKPYRCDVCNYSTTTKGNLSIHMQSDKHLANLQGFQ
AGPGGQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKHMQNVLML
HQGLPLGLPPGLMGPGPPPPPGATPTSPPELFQYFGPQALGQPQTPLAGPGLRPDKPLEA
QLLLNGFHHVGAPARKFPTSAPGSLSPDAHLPPSQLLGSSSDSLPTSPPPDDSLSLKVFR
CLVCQAFSTDSLELLLYHCSIGRSLPEAEWKEVAGDTHRCKLCCYGTQLKANFQLHLKTD
KHAQKYQLAAHLREGGGAMGTPSPASLGDGAPYGSVSPLHLRCNICDFESNSKEKMQLHA
RGAAHEENSQIYKFLLDMEGAEAGAELGLYHCLLCAWETPSRLAVLQHLRTPAHRDAQAQ
RRLQLLQNGPTTEEGLAALQSILSFSHGQLRTPGKAPVTPLAEPPTPEKDAQNKTEQLAS
EETENKTGPSRDSANQTTVYCCPYCSFLSPESSQVRAHTLSQHAVQPKYRCPLCQEQLVG
RPALHFHLSHLHNVVPECVEKLLLVATTVEMTFTTKVLSAPTLSPLDNGQEPPTHGPEPT
PSRDQAAEGPNLTPEASPDPLPEPPLASVEVPDKPSGSPGQPPSPAPSPVPEPDAQAEDV
APPPTMAEEEEGTTGELRSAEPAPADSRHPLTYRKTTNFALDKFLDPARPYKCTVCKESF
TQKNILLVHYNSVSHLHKMKKAAIDPSAPARGEAGAPPTTTAATDKPFKCTVCRVSYNQS
STLEIHMRSVLHQTRSRGTKTDSKIEGPERSQEEPKEGETEGEVGTEKKGPDTSGFISGL
PFLSPPPPPLDLHRFPAPLFTPPVLPPFPLVPESLLKLQQQQLLLPFYLHDLKVGPKLTL
AGPAPVLSLPAATPPPPPQPPKAELAEREWERPPMAKEGNEAGPSSPPDPLPNEAARTAA
KALLENFGFELVIQYNEGKQAVPPPPTPPPPEALGGGDKLACGACGKLFSNMLILKTHEE
HVHRRFLPFEALSRYAAQFRKSYDSLYPPLAEPPKPPDGSLDSPVPHLGPPFLVPEPEAG
GTRAPEERSRAGGHWPIEEEESSRGNLPPLVPAGRRFSRTKFTEFQTQALQSFFETSAYP
KDGEVERLASLLGLASRVVVVWFQNARQKARKNACEGGSMPTGGGTGGASGCRRCHATFS
CVFELVRHLKKCYDDQTLEEEEEEAERGEEEEEVEEEEVEEEQGLEPPAGPEGPLPEPPD
GEELSQAEATKAGGKEPEEKATPSPSPAHTCDQCAISFSSQDLLTSHRRLHFLPSLQPSA
PPQLLDLPLLVFGERNPLVAATSPMPGPPLKRKHEDGSLSPTGSEAGGGGEGEPPRDKRL
RTTILPEQLEILYRWYMQDSNPTRKMLDCISEEVGLKKRVVQVWFQNTRARERKGQFRST
PGGVPSPAVKPPATATPASLPKFNLLLGKVDDGTGREAPKREAPAFPYPTATLASGPQPF
LPPGKEATTPTPEPPLPLLPPPPPSEEEGPEEPPKASPESEACSLSAGDLSDSSASSLAE
PESPGAGGTSGGPGGGTGVPDGMGQRRYRTQMSSLQLKIMKACYEAYRTPTMQECEVLGE
EIGLPKRVIQVWFQNARAKEKKAKLQGTAAGSTGGSSEGLLAAQRTDCPYCDVKYDFYVS
CRGHLFSRQHLAKLKEAVRAQLKSESKCYDLAPAPEAPPALKAPPATTPASMPLGAAPTL
PRLAPVLLSGPALAQPPLGNLAPFNSGPAASSGLLGLATSVLPTTTVVQTAGPGRPLPQR
PMPDQTNTSTAGTTDPVPGPPTEPLGDKVSSERKPVAGPTSSSNDALKNLKALKTTVPAL
LGGQFLPFPLPPAGGTAPPAVFGPQLQGAYFQQLYGMKKGLFPMNPMIPQTLIGLLPNAL
LQPPPQPPEPTATAPPKPPELPAPGEGEAGEVDELLTGSTGISTVDVTHRYLCRQCKMAF
DGEAPATAHQRSFCFFGRGSGGSMPPPLRVPICTYHCLACEVLLSGREALASHLRSSAHR
RKAAPPQGGPPISITNAATAASAAVAFAKEEARLPHTDSNPKTTTTSTLLAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0A1	0.999	0.999	0.000	2572	1.000	1.000	Q9C0A1.pdb.gz	ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens OX=9606 GN=ZFHX2 PE=1 SV=3
2	AFDB:Q7TSH3	0.032	0.055	5.301E-9	1157	0.086	0.190	Q7TSH3.pdb.gz	ZN516_MOUSE Zinc finger protein 516 OS=Mus musculus OX=10090 GN=Znf516 PE=1 SV=1
3	AFDB:Q383H0	0.029	0.042	2.718E-6	1439	0.090	0.161	Q383H0.pdb.gz	Q383H0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2880 PE=4 SV=1
4	AFDB:A0A0K3AUE4	0.033	0.037	7.793E-5	1968	0.113	0.147	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
5	AFDB:A0A0B4K6Y7	0.032	0.034	9.120E-5	2395	0.128	0.137	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
6	AFDB:Q8IY92	0.033	0.042	1.900E-4	1834	0.118	0.166	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
7	AFDB:Q8WYB5	0.036	0.040	5.146E-4	2073	0.099	0.123	Q8WYB5.pdb.gz	KAT6B_HUMAN Histone acetyltransferase KAT6B OS=Homo sapiens OX=9606 GN=KAT6B PE=1 SV=3
8	AFDB:P78332	0.031	0.051	5.423E-4	1123	0.072	0.165	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
9	AFDB:A0A0R4INF0	0.032	0.045	6.347E-4	1570	0.108	0.177	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
10	AFDB:Q9VRM6	0.033	0.040	9.162E-4	1929	0.124	0.166	Q9VRM6.pdb.gz	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
11	PDB:2hi3A	0.025	0.649	1.664E-1	73	0.006	0.205	2hi3A.pdb.gz
12	PDB:4egcA	0.020	0.094	1.948E-1	539	0.005	0.026	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
13	PDB:3w5kB	0.021	0.217	2.403E-1	110	0.008	0.191	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
14	PDB:3javA	0.033	0.035	1.286	2327	0.097	0.107	3javA.pdb.gz
15	PDB:7fbyA	0.020	0.239	1.857	153	0.005	0.085	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
16	PDB:5zwmv	0.016	0.211	2.290	174	0.004	0.057	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
17	PDB:7oqyY	0.011	0.189	2.290	92	0.005	0.130	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
18	PDB:5gm6I	0.019	0.299	3.306	102	0.006	0.157	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:5z56L	0.018	0.129	3.306	342	0.005	0.035	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
20	PDB:5nr5A	0.021	0.361	3.671	113	0.006	0.133	5nr5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRC6	0.0	687	408	0.137	0.865	A2RRC6_HUMAN ZFHX2 protein OS=Homo sapiens OX=9606 GN=ZFHX2 PE=1 SV=1
2	Q2MHN3	0.0	3741	2562	0.836	0.840	ZFHX2_MOUSE Zinc finger homeobox protein 2 OS=Mus musculus OX=10090 GN=Zfhx2 PE=1 SV=1
3	Q9C0A1	0.0	5167	2572	1.000	1.000	ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens OX=9606 GN=ZFHX2 PE=1 SV=3
4	Q15911	1.02e-146	516	3703	0.114	0.079	ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2
5	Q61329	1.21e-145	513	3726	0.116	0.080	ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musculus OX=10090 GN=Zfhx3 PE=1 SV=1
6	F1M4Q6	2.07e-144	509	3730	0.110	0.076	F1M4Q6_RAT Zinc finger homeobox 3 OS=Rattus norvegicus OX=10116 GN=Zfhx3 PE=4 SV=3
7	Q9JJN2	2.01e-135	480	3550	0.124	0.090	ZFHX4_MOUSE Zinc finger homeobox protein 4 OS=Mus musculus OX=10090 GN=Zfhx4 PE=1 SV=1
8	P28167	2.57e-46	187	3005	0.037	0.031	ZFH2_DROME Zinc finger protein 2 OS=Drosophila melanogaster OX=7227 GN=zfh2 PE=1 SV=2
9	Q8IRC7	4.29e-11	68.6	275	0.014	0.127	AWH_DROME LIM/homeobox protein Awh OS=Drosophila melanogaster OX=7227 GN=Awh PE=1 SV=1
10	Q1LWV4	6.97e-11	69.3	396	0.024	0.154	LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio OX=7955 GN=lhx9 PE=2 SV=1
11	Q68G74	7.28e-11	68.9	356	0.021	0.149	LHX8_HUMAN LIM/homeobox protein Lhx8 OS=Homo sapiens OX=9606 GN=LHX8 PE=1 SV=2
12	Q9WUH2	1.07e-10	68.6	397	0.024	0.159	LHX9_MOUSE LIM/homeobox protein Lhx9 OS=Mus musculus OX=10090 GN=Lhx9 PE=1 SV=3
13	O35652	1.13e-10	68.6	367	0.016	0.109	LHX8_MOUSE LIM/homeobox protein Lhx8 OS=Mus musculus OX=10090 GN=Lhx8 PE=2 SV=4
14	Q9NQ69	1.15e-10	68.6	397	0.024	0.156	LHX9_HUMAN LIM/homeobox protein Lhx9 OS=Homo sapiens OX=9606 GN=LHX9 PE=1 SV=3
15	G5EEA1	4.21e-10	66.6	355	0.012	0.090	LIM4_CAEEL LIM/homeobox protein lim-4 OS=Caenorhabditis elegans OX=6239 GN=lim-4 PE=1 SV=1
16	M9PJE4	4.42e-10	66.2	347	0.020	0.150	M9PJE4_DROME LIM homeobox 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Lim1 PE=4 SV=1
17	O88609	4.59e-10	66.6	395	0.015	0.096	LMX1B_MOUSE LIM homeobox transcription factor 1-beta OS=Mus musculus OX=10090 GN=Lmx1b PE=1 SV=3
18	O60663	4.63e-10	66.6	402	0.015	0.095	LMX1B_HUMAN LIM homeobox transcription factor 1-beta OS=Homo sapiens OX=9606 GN=LMX1B PE=1 SV=3
19	Q9UPM6	6.64e-10	65.9	363	0.012	0.088	LHX6_HUMAN LIM/homeobox protein Lhx6 OS=Homo sapiens OX=9606 GN=LHX6 PE=1 SV=2
20	Q9V472	6.64e-10	66.6	505	0.020	0.103	Q9V472_DROME DLim1 OS=Drosophila melanogaster OX=7227 GN=Lim1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	1.5e-05	36.1	Homeobox KN domain
2	PF00046 Homeodomain	1.2e-45	164.5	Homeodomain
3	PF01803 LIM_bind	1e+02	13.8	LIM-domain binding protein
4	PF00096 zf-C2H2	1.9	20.2	Zinc finger, C2H2 type
5	PF12756 zf-C2H2_2	0.011	27.4	C2H2 type zinc-finger (2 copies)
6	PF13894 zf-C2H2_4	5.1e+02	13.0	C2H2-type zinc finger
7	PF05605 zf-Di19	26	16.5	Drought induced 19 protein (Di19), zinc-binding
8	PF13909 zf-H2C2_5	0.15	23.1	C2H2-type zinc-finger domain
9	PF12874 zf-met	2.6	19.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000413418

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356917	0.699	Olfactomedin-like protein 2B
2	9606.ENSP00000298681	0.698	Zinc transporter ZIP2
3	9606.ENSP00000368984	0.696	Exosome complex component RRP45
4	9606.ENSP00000263168	0.679	F-actin-capping protein subunit alpha-1
5	9606.ENSP00000346027	0.609	60S ribosomal protein L21
6	9606.ENSP00000431603	0.591	POU domain, class 2, transcription factor 2
7	9606.ENSP00000216727	0.587	Polyadenylate-binding protein 2
8	9606.ENSP00000357005	0.577	Junctional adhesion molecule A
9	9606.ENSP00000333735	0.557	Nuclear pore-associated protein 1
10	9606.ENSP00000452479	0.542	BCL2L2-PABPN1 readthrough
11	9606.ENSP00000369592	0.513	Coiled-coil domain-containing protein 85C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.924	DNA binding
GO:0043565	0.782	sequence-specific DNA binding
GO:1990837	0.746	sequence-specific double-stranded DNA binding
GO:0140110	0.550	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	1.000	regulation of biological process
GO:0051239	0.975	regulation of multicellular organismal process
GO:0051931	0.970	regulation of sensory perception
GO:0051930	0.942	regulation of sensory perception of pain
GO:0032501	0.520	multicellular organismal process
GO:0050794	0.513	regulation of cellular process
GO:0009987	0.426	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.605	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]