StarFunc result for job id Q9C0A6

User Input

>input (1442 residues)
MSIAIPLGVTTSDTSYSDMAAGSDPESVEASPAVNEKSVYSTHNYGTTQRHGCRGLPYAT
IIPRSDLNGLPSPVEERCGDSPNSEGETVPTWCPCGLSQDGFLLNCDKCRGMSRGKVIRL
HRRKQDNISGGDSSATESWDEELSPSTVLYTATQHTPTSITLTVRRTKPKKRKKSPEKGR
AAPKTKKIKNSPSEAQNLDENTTEGWENRIRLWTDQYEEAFTNQYSADVQNALEQHLHSS
KEFVGKPTILDTINKTELACNNTVIGSQMQLQLGRVTRVQKHRKILRAARDLALDTLIIE
YRGKVMLRQQFEVNGHFFKKPYPFVLFYSKFNGVEMCVDARTFGNDARFIRRSCTPNAEV
RHMIADGMIHLCIYAVSAITKDAEVTIAFDYEYSNCNYKVDCACHKGNRNCPIQKRNPNA
TELPLLPPPPSLPTIGAETRRRKARRKELEMEQQNEASEENNDQQSQEVPEKVTVSSDHE
EVDNPEEKPEEEKEEVIDDQENLAHSRRTREDRKVEAIMHAFENLEKRKKRRDQPLEQSN
SDVEITTTTSETPVGEETKTEAPESEVSNSVSNVTIPSTPQSVGVNTRRSSQAGDIAAEK
LVPKPPPAKPSRPRPKSRISRYRTSSAQRLKRQKQANAQQAELSQAALEEGGSNSLVTPT
EAGSLDSSGENRPLTGSDPTVVSITGSHVNRAASKYPKTKKYLVTEWLNDKAEKQECPVE
CPLRITTDPTVLATTLNMLPGLIHSPLICTTPKHYIRFGSPFIPERRRRPLLPDGTFSSC
KKRWIKQALEEGMTQTSSVPQETRTQHLYQSNENSSSSSICKDNADLLSPLKKWKSRYLM
EQNVTKLLRPLSPVTPPPPNSGSKSPQLATPGSSHPGEEECRNGYSLMFSPVTSLTTASR
CNTPLQFELCHRKDLDLAKVGYLDSNTNSCADRPSLLNSGHSDLAPHPSLGPTSETGFPS
RSGDGHQTLVRNSDQAFRTEFNLMYAYSPLNAMPRADGLYRGSPLVGDRKPLHLDGGYCS
PAEGFSSRYEHGLMKDLSRGSLSPGGERACEGVPSAPQNPPQRKKVSLLEYRKRKQEAKE
NSAGGGGDSAQSKSKSAGAGQGSSNSVSDTGAHGVQGSSARTPSSPHKKFSPSHSSMSHL
EAVSPSDSRGTSSSHCRPQENISSRWMVPTSVERLREGGSIPKVLRSSVRVAQKGEPSPT
WESNITEKDSDPADGEGPETLSSALSKGATVYSPSRYSYQLLQCDSPRTESQSLLQQSSS
PFRGHPTQSPGYSYRTTALRPGNPPSHGSSESSLSSTSYSSPAHPVSTDSLAPFTGTPGY
FSSQPHSGNSTGSNLPRRSCPSSAASPTLQGPSDSPTSDSVSQSSTGTLSSTSFPQNSRS
SLPSDLRTISLPSAGQSAVYQASRVSAVSNSQHYPHRGSGGVHQYRLQPLQGSGVKTQTG
LS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0A6	0.999	0.999	0.000	1442	1.000	1.000	Q9C0A6.pdb.gz	SETD5_HUMAN Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2
2	AFDB:Q8IZD2	0.145	0.118	6.526E-54	1858	0.334	0.259	Q8IZD2.pdb.gz	KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1
3	AFDB:Q3UG20	0.144	0.114	4.247E-52	1868	0.331	0.255	Q3UG20.pdb.gz	KMT2E_MOUSE Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2
4	AFDB:Q9W5E0	0.091	0.100	2.828E-13	1300	0.141	0.157	Q9W5E0.pdb.gz	SUV42_DROME Histone-lysine N-methyltransferase Suv4-20 OS=Drosophila melanogaster OX=7227 GN=Hmt4-20 PE=1 SV=1
5	PDB:5hynA	0.086	0.202	2.338E-9	581	0.022	0.055	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
6	PDB:5wg6A	0.073	0.196	5.668E-9	517	0.018	0.050	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
7	PDB:7td5F	0.076	0.233	1.290E-8	447	0.017	0.056	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
8	PDB:1pegA	0.085	0.381	5.528E-8	266	0.021	0.113	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
9	PDB:6wkrC	0.079	0.181	7.120E-8	606	0.017	0.041	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
10	PDB:7td5A	0.075	0.209	7.120E-8	497	0.018	0.052	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
11	PDB:7ksoA	0.075	0.257	7.585E-8	395	0.017	0.061	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
12	AFDB:B2GM62	0.063	0.078	1.293E-7	1142	0.121	0.153	B2GM62.pdb.gz
13	AFDB:Q9VVC6	0.036	0.032	1.343E-6	2029	0.160	0.114	Q9VVC6.pdb.gz	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3
14	AFDB:A2A7B5	0.073	0.064	8.961E-6	1709	0.126	0.106	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
15	AFDB:Q13029	0.073	0.062	2.040E-5	1718	0.133	0.112	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
16	AFDB:D4A0R1	0.071	0.091	2.981E-5	1090	0.111	0.147	D4A0R1.pdb.gz	D4A0R1_RAT Zinc finger protein, multitype 2 OS=Rattus norvegicus OX=10116 GN=Zfpm2 PE=4 SV=4
17	PDB:5h6zA	0.065	0.613	4.242E-5	123	0.010	0.114	5h6zA.pdb.gz
18	AFDB:D3ZGB1	0.037	0.035	4.946E-5	1548	0.152	0.141	D3ZGB1.pdb.gz	NFAT5_RAT Nuclear factor of activated T-cells 5 OS=Rattus norvegicus OX=10116 GN=Nfat5 PE=1 SV=1
19	PDB:2g46A	0.066	0.620	5.128E-5	119	0.013	0.160	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
20	PDB:5ex0A	0.043	0.131	4.298E-3	429	0.014	0.047	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EWN3	0.0	2954	1461	1.000	0.987	E7EWN3_HUMAN SET domain containing 5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=1
2	H0Y3R4	0.0	1869	911	0.630	0.998	H0Y3R4_HUMAN SET domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=1
3	Q5XJV7	0.0	2531	1441	0.938	0.938	SETD5_MOUSE Histone-lysine N-methyltransferase SETD5 OS=Mus musculus OX=10090 GN=Setd5 PE=1 SV=2
4	Q9C0A6	0.0	2966	1442	1.000	1.000	SETD5_HUMAN Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2
5	Q8IZD2	1.42e-170	560	1858	0.275	0.213	KMT2E_HUMAN Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E PE=1 SV=1
6	Q3UG20	4.28e-170	559	1868	0.276	0.213	KMT2E_MOUSE Inactive histone-lysine N-methyltransferase 2E OS=Mus musculus OX=10090 GN=Kmt2e PE=1 SV=2
7	Q9VUB5	9.33e-22	105	3146	0.052	0.024	Q9VUB5_DROME UpSET, isoform A OS=Drosophila melanogaster OX=7227 GN=upSET PE=1 SV=3
8	O44498	1.93e-11	71.6	1623	0.032	0.028	SET9_CAEEL Histone-lysine N-methyltransferase set-9 OS=Caenorhabditis elegans OX=6239 GN=set-9 PE=1 SV=2
9	Q9U263	2.26e-11	71.6	1645	0.032	0.028	SET26_CAEEL Histone-lysine N-methyltransferase set-26 OS=Caenorhabditis elegans OX=6239 GN=set-26 PE=1 SV=3
10	Q9VYD1	8.28e-11	69.7	2313	0.032	0.020	C1716_DROME Probable histone-lysine N-methyltransferase CG1716 OS=Drosophila melanogaster OX=7227 GN=Set2 PE=1 SV=2
11	F1M0L3	3.29e-10	67.8	3986	0.027	0.010	F1M0L3_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2a PE=1 SV=4
12	P55200	3.51e-10	67.8	3966	0.027	0.010	KMT2A_MOUSE Histone-lysine N-methyltransferase 2A OS=Mus musculus OX=10090 GN=Kmt2a PE=1 SV=3
13	Q03164	3.57e-10	67.8	3969	0.027	0.010	KMT2A_HUMAN Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5
14	A0A8I6AUV5	5.05e-10	67.0	2426	0.024	0.014	A0A8I6AUV5_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
15	E9Q5F9	5.08e-10	67.0	2537	0.024	0.014	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
16	Q2LAE1	5.14e-10	67.0	1759	0.028	0.023	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
17	A0A8I6A5I9	5.62e-10	67.0	2526	0.024	0.014	A0A8I6A5I9_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
18	A0A8I6A709	5.81e-10	67.0	2520	0.024	0.014	A0A8I6A709_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
19	A0A8I5ZLS2	6.34e-10	66.6	2419	0.024	0.014	A0A8I5ZLS2_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
20	A0A0G2KB10	6.37e-10	66.6	2523	0.024	0.014	A0A0G2KB10_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00856 SET	0.081	24.8	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385852

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000436786	0.876	Histone-lysine N-methyltransferase 2A
2	9606.ENSP00000339532	0.816	THUMP domain-containing protein 3
3	9606.ENSP00000373354	0.775	Histone-lysine N-methyltransferase SETMAR
4	9606.ENSP00000268712	0.768	Nuclear receptor corepressor 1
5	9606.ENSP00000386759	0.760	Histone-lysine N-methyltransferase SETD2
6	9606.ENSP00000262189	0.751	Histone-lysine N-methyltransferase 2C
7	9606.ENSP00000282003	0.720	E3 ubiquitin ligase essential for DNA replication origin activation during S phase . Acts as a replication origin selector which selects the origins to be fired and catalyzes the multi-mono-ubiquitination of a subset of chromatin-bound ORC3 and ORC5 during S-phase
8	9606.ENSP00000296003	0.708	Myotubularin-related protein 14
9	9606.ENSP00000419184	0.700	Histone-lysine N-methyltransferase SMYD3
10	9606.ENSP00000235372	0.677	PR domain zinc finger protein 2
11	9606.ENSP00000307208	0.675	Nucleosome-remodeling factor subunit BPTF
12	9606.ENSP00000305899	0.671	Histone-lysine N-methyltransferase KMT5B
13	9606.ENSP00000382163	0.669	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
14	9606.ENSP00000340648	0.649	E3 ubiquitin-protein ligase HUWE1
15	9606.ENSP00000405574	0.643	F-box-like/WD repeat-containing protein TBL1XR1
16	9606.ENSP00000346175	0.640	Histone-lysine N-methyltransferase SETDB2
17	9606.ENSP00000274031	0.632	Histone-lysine N-methyltransferase SETD7
18	9606.ENSP00000374152	0.630	SET and MYND domain-containing protein 5
19	9606.ENSP00000276570	0.621	DnaJ heat shock protein family member C5 beta
20	9606.ENSP00000354111	0.615	DnaJ homolog subfamily C member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016279	0.967	protein-lysine N-methyltransferase activity
GO:0042054	0.959	histone methyltransferase activity
GO:0018024	0.909	histone lysine N-methyltransferase activity
GO:0140938	0.636	histone H3 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010468	0.997	regulation of gene expression
GO:0051252	0.997	regulation of RNA metabolic process
GO:0009889	0.975	regulation of biosynthetic process
GO:0006355	0.973	regulation of DNA-templated transcription
GO:0006359	0.855	regulation of transcription by RNA polymerase III
GO:1902275	0.844	regulation of chromatin organization
GO:0048519	0.729	negative regulation of biological process
GO:0048523	0.710	negative regulation of cellular process
GO:0010605	0.703	negative regulation of macromolecule metabolic process
GO:0051172	0.677	negative regulation of nitrogen compound metabolic process
GO:0031324	0.677	negative regulation of cellular metabolic process
GO:0045934	0.632	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.580	negative regulation of RNA metabolic process
GO:0010558	0.576	negative regulation of macromolecule biosynthetic process
GO:0045892	0.572	negative regulation of DNA-templated transcription
GO:0009987	0.537	cellular process
GO:0032501	0.528	multicellular organismal process
GO:0048518	0.444	positive regulation of biological process
GO:0048522	0.367	positive regulation of cellular process
GO:0032784	0.360	regulation of DNA-templated transcription elongation
GO:0010604	0.338	positive regulation of macromolecule metabolic process
GO:0071704	0.337	organic substance metabolic process
GO:0051173	0.333	positive regulation of nitrogen compound metabolic process
GO:0031325	0.329	positive regulation of cellular metabolic process
GO:0065008	0.327	regulation of biological quality
GO:0050890	0.312	cognition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.470	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	0.967	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]