StarFunc result for job id Q9C0B0

User Input

>input (810 residues)
MSKGPGPGGSAASSAPPAATAQVLQAQPEKPQHYTYLKEFRTEQCPLFVQHKCTQHRPYT
CFHWHFVNQRRRRSIRRRDGTFNYSPDVYCTKYDEATGLCPEGDECPFLHRTTGDTERRY
HLRYYKTGICIHETDSKGNCTKNGLHCAFAHGPHDLRSPVYDIRELQAMEALQNGQTTVE
GSIEGQSAGAASHAMIEKILSEEPRWQETAYVLGNYKTEPCKKPPRLCRQGYACPYYHNS
KDRRRSPRKHKYRSSPCPNVKHGDEWGDPGKCENGDACQYCHTRTEQQFHPEIYKSTKCN
DMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSS
PHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGESGLAPGSYKKAPGFER
EDQVGAEYLKNFKCQAKLKPHSLEPRSQEQPLLQPKQDMLGILPAGSPLTSSISSSITSS
LAATPPSPVGTSSVPGMNANALPFYPTSDTVESVIESALDDLDLNEFGVAALEKTFDNST
VPHPGSITIGGSLLQSSAPVNIPGSLGSSASFHSASPSPPVSLSSHFLQQPQGHLSQSEN
TFLGTSASHGSLGLNGMNSSIWEHFASGSFSPGTSPAFLSGPGAAELARLRQELDEANST
IKQWEESWKQAKQACDAWKKEAEEAGERASAAGAECELAREQRDALEVQVKKLQEELERL
HAGPEPQALPAFSDLEALSLSTLYSLQKQLRAHLEQVDKAVFHMQSVKCLKCQEQKRAVL
PCQHAALCELCAEGSECPICQPGRAHTLQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BL48	0.540	0.540	0.000	810	0.954	0.954	Q8BL48.pdb.gz	UNK_MOUSE RING finger protein unkempt homolog OS=Mus musculus OX=10090 GN=Unk PE=1 SV=1
2	AFDB:Q86B79	0.288	0.374	1.550E-54	599	0.358	0.484	Q86B79.pdb.gz	UNK_DROME RING finger protein unkempt OS=Drosophila melanogaster OX=7227 GN=unk PE=1 SV=1
3	AFDB:A6H5Y1	0.093	0.078	2.593E-2	991	0.104	0.085	A6H5Y1.pdb.gz	MPP9_MOUSE M-phase phosphoprotein 9 OS=Mus musculus OX=10090 GN=Mphosph9 PE=2 SV=2
4	AFDB:Q5JR59	0.087	0.056	1.399E-1	1369	0.115	0.068	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
5	AFDB:M0QXN5	0.122	0.208	2.360E-1	446	0.085	0.155	M0QXN5.pdb.gz	M0QXN5_HUMAN Nucleoporin 62 OS=Homo sapiens OX=9606 GN=NUP62 PE=1 SV=1
6	AFDB:Q9JJ11	0.088	0.109	2.651E-1	631	0.102	0.132	Q9JJ11.pdb.gz	TACC3_MOUSE Transforming acidic coiled-coil-containing protein 3 OS=Mus musculus OX=10090 GN=Tacc3 PE=1 SV=1
7	AFDB:Q9UPV0	0.064	0.041	3.345E-1	1460	0.102	0.057	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
8	AFDB:E9Q842	0.088	0.036	5.024E-1	2432	0.110	0.037	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
9	AFDB:P34531	0.102	0.089	7.998E-1	937	0.093	0.080	P34531.pdb.gz	CLP1H_CAEEL CAP-Gly domain-containing linker protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=clip-1 PE=4 SV=4
10	AFDB:P38814	0.046	0.044	1.009	852	0.070	0.067	P38814.pdb.gz	SBE22_YEAST Protein SBE22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SBE22 PE=1 SV=1
11	PDB:7bvfA	0.026	0.021	2.968	1087	0.014	0.010	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
12	PDB:4v8mBr	0.050	0.087	6.696	367	0.014	0.030	4v8mBr.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
13	PDB:7astM	0.034	0.026	8.954	1114	0.009	0.006	7astM.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BL48	0.0	1499	810	0.931	0.931	UNK_MOUSE RING finger protein unkempt homolog OS=Mus musculus OX=10090 GN=Unk PE=1 SV=1
2	Q9C0B0	0.0	1668	810	1.000	1.000	UNK_HUMAN RING finger protein unkempt homolog OS=Homo sapiens OX=9606 GN=UNK PE=1 SV=2
3	E9PDK2	2.29e-161	486	683	0.285	0.338	E9PDK2_HUMAN Unk like zinc finger OS=Homo sapiens OX=9606 GN=UNKL PE=1 SV=2
4	A0A0A0MRZ1	2.70e-161	488	733	0.285	0.315	A0A0A0MRZ1_HUMAN Unk like zinc finger OS=Homo sapiens OX=9606 GN=UNKL PE=1 SV=2
5	Q86B79	3.91e-159	478	599	0.278	0.376	UNK_DROME RING finger protein unkempt OS=Drosophila melanogaster OX=7227 GN=unk PE=1 SV=1
6	Q9H9P5	7.91e-157	474	680	0.281	0.335	UNKL_HUMAN Putative E3 ubiquitin-protein ligase UNKL OS=Homo sapiens OX=9606 GN=UNKL PE=1 SV=3
7	Q9LUZ4	1.01e-09	64.3	607	0.059	0.079	C3H66_ARATH Zinc finger CCCH domain-containing protein 66 OS=Arabidopsis thaliana OX=3702 GN=At5g58620 PE=2 SV=1
8	Q9XEE6	1.58e-09	63.9	597	0.075	0.102	C3H29_ARATH Zinc finger CCCH domain-containing protein 29 OS=Arabidopsis thaliana OX=3702 GN=At2g40140 PE=1 SV=1
9	Q9LXV4	1.67e-09	63.9	706	0.069	0.079	C3H56_ARATH Zinc finger CCCH domain-containing protein 56 OS=Arabidopsis thaliana OX=3702 GN=At5g12850 PE=2 SV=1
10	Q9FU27	1.93e-09	62.8	386	0.041	0.085	C3H2_ORYSJ Zinc finger CCCH domain-containing protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0192000 PE=2 SV=1
11	P93755	5.08e-09	62.4	716	0.058	0.066	C3H30_ARATH Zinc finger CCCH domain-containing protein 30 OS=Arabidopsis thaliana OX=3702 GN=At2g41900 PE=1 SV=2
12	Q9M0G2	1.36e-08	60.1	356	0.081	0.185	C3H49_ARATH Zinc finger CCCH domain-containing protein 49 OS=Arabidopsis thaliana OX=3702 GN=At4g29190 PE=2 SV=1
13	Q93ZS9	1.88e-08	60.5	580	0.062	0.086	C3H47_ARATH Zinc finger CCCH domain-containing protein 47 OS=Arabidopsis thaliana OX=3702 GN=At3g55980 PE=2 SV=1
14	O82199	7.54e-08	57.8	359	0.056	0.125	C3H20_ARATH Zinc finger CCCH domain-containing protein 20 OS=Arabidopsis thaliana OX=3702 GN=At2g19810 PE=2 SV=1
15	Q7YXD9	8.55e-08	57.8	419	0.044	0.086	Q7YXD9_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=1 SV=1
16	Q20155	9.86e-08	57.8	460	0.044	0.078	Q20155_CAEEL C3H1-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccch-1 PE=4 SV=3
17	O82307	1.43e-07	56.6	315	0.038	0.098	C3H23_ARATH Zinc finger CCCH domain-containing protein 23 OS=Arabidopsis thaliana OX=3702 GN=At2g25900 PE=2 SV=1
18	Q9ZWA1	2.69e-06	52.8	393	0.038	0.079	C3H2_ARATH Zinc finger CCCH domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=TZF4 PE=1 SV=1
19	O65036	3.21e-06	51.6	245	0.036	0.118	C3H54_ARATH Zinc finger CCCH domain-containing protein 54 OS=Arabidopsis thaliana OX=3702 GN=TZF6 PE=1 SV=1
20	Q9FKW2	3.06e-05	49.7	381	0.040	0.084	C3H61_ARATH Zinc finger CCCH domain-containing protein 61 OS=Arabidopsis thaliana OX=3702 GN=TZF5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13094 CENP-Q	6.3e+02	11.9	CENP-Q, a CENPA-CAD centromere complex subunit
2	PF11932 DUF3450	0.25	22.2	Protein of unknown function (DUF3450)
3	PF12083 DUF3560	2.7e+02	13.1	Domain of unknown function (DUF3560)
4	PF13870 DUF4201	39	15.4	Domain of unknown function (DUF4201)
5	PF14362 DUF4407	14	16.5	Domain of unknown function (DUF4407)
6	PF20072 DUF6468	3.7e+02	12.7	Domain of unknown function (DUF6468)
7	PF06818 Fez1	1.1e+02	14.7	Fez1
8	PF00038 Filament	2.5e+02	12.7	Intermediate filament protein
9	PF05615 THOC7	12	17.6	Tho complex subunit 7
10	PF13920 zf-C3HC4_3	1.3	20.2	Zinc finger, C3HC4 type (RING finger)
11	PF00642 zf-CCCH	0.13	23.5	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
12	PF14608 zf-CCCH_2	2.3e+02	13.8	RNA-binding, Nab2-type zinc finger
13	PF18345 zf_CCCH_4	1.8	19.9	Zinc finger domain
14	PF18384 zf_CCCH_5	3.4e-18	76.8	Unkempt Zinc finger domain 1 (Znf1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000464893

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356630	0.989	Headcase protein homolog
2	9606.ENSP00000307272	0.913	Regulatory-associated protein of mTOR
3	9606.ENSP00000316357	0.850	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
4	9606.ENSP00000412927	0.834	HLA class I histocompatibility antigen, alpha chain G
5	9606.ENSP00000371333	0.806	Natural killer cells antigen CD94
6	9606.ENSP00000381577	0.777	Ubiquitin carboxyl-terminal hydrolase 34
7	9606.ENSP00000265339	0.758	Ubiquitin-conjugating enzyme E2 B
8	9606.ENSP00000265960	0.731	Target of rapamycin complex 2 subunit MAPKAP1
9	9606.ENSP00000444856	0.712	Cullin-2
10	9606.ENSP00000456405	0.710	Target of rapamycin complex subunit LST8
11	9606.ENSP00000365402	0.694	HLA class I histocompatibility antigen, Cw-7 alpha chain
12	9606.ENSP00000347498	0.683	Abscission/NoCut checkpoint regulator
13	9606.ENSP00000363019	0.679	Ubiquitin-conjugating enzyme E2 D1
14	9606.ENSP00000362314	0.674	Eukaryotic translation initiation factor 4E-binding protein 2
15	9606.ENSP00000246548	0.670	SUMO-activating enzyme subunit 2
16	9606.ENSP00000348838	0.660	Ubiquitin-conjugating enzyme E2 C
17	9606.ENSP00000478927	0.660	Transcriptional coactivator YAP1
18	9606.ENSP00000417378	0.655	ATPase H+ transporting V1 subunit F
19	9606.ENSP00000371388	0.645	Sulfiredoxin-1
20	9606.ENSP00000339634	0.642	Killer cell immunoglobulin-like receptor 2DL4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003729	1.000	mRNA binding
GO:1990715	0.984	mRNA CDS binding
GO:0005515	0.941	protein binding
GO:0043021	0.906	ribonucleoprotein complex binding
GO:1905538	0.623	polysome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032501	0.980	multicellular organismal process
GO:0032502	0.978	developmental process
GO:0065007	0.977	biological regulation
GO:0048869	0.974	cellular developmental process
GO:0050794	0.966	regulation of cellular process
GO:0048856	0.960	anatomical structure development
GO:0007275	0.947	multicellular organism development
GO:0030154	0.866	cell differentiation
GO:0048731	0.849	system development
GO:0007399	0.833	nervous system development
GO:0019222	0.806	regulation of metabolic process
GO:0060255	0.768	regulation of macromolecule metabolic process
GO:0051171	0.734	regulation of nitrogen compound metabolic process
GO:0010468	0.734	regulation of gene expression
GO:0048519	0.711	negative regulation of biological process
GO:0048699	0.707	generation of neurons
GO:0080090	0.698	regulation of primary metabolic process
GO:0048523	0.672	negative regulation of cellular process
GO:0031323	0.669	regulation of cellular metabolic process
GO:0010605	0.466	negative regulation of macromolecule metabolic process
GO:0010629	0.445	negative regulation of gene expression
GO:0051246	0.433	regulation of protein metabolic process
GO:0010556	0.431	regulation of macromolecule biosynthetic process
GO:0031326	0.430	regulation of cellular biosynthetic process
GO:0051248	0.349	negative regulation of protein metabolic process
GO:0010608	0.321	post-transcriptional regulation of gene expression
GO:0008152	0.312	metabolic process
GO:2000765	0.311	regulation of cytoplasmic translation
GO:0050896	0.310	response to stimulus
GO:0031324	0.301	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005622	0.957	intracellular anatomical structure
GO:0005737	0.942	cytoplasm
GO:0005829	0.892	cytosol
GO:0005844	0.801	polysome
GO:0043229	0.679	intracellular organelle
GO:0005634	0.528	nucleus
GO:0070013	0.468	intracellular organelle lumen
GO:0016020	0.414	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]