StarFunc result for job id Q9C0B1

User Input

>input (505 residues)
MKRTPTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLILREASSVSEE
LHKEVQEAFLTLHKHGCLFRDLVRIQGKDLLTPVSRILIGNPGCTYKYLNTRLFTVPWPV
KGSNIKHTEAEIAAACETFLKLNDYLQIETIQALEELAAKEKANEDAVPLCMSADFPRVG
MGSSYNGQDEVDIKSRAAYNVTLLNFMDPQKMPYLKEEPYFGMGKMAVSWHHDENLVDRS
AVAVYSYSCEGPEEESEDDSHLEGRDPDIWHVGFKISWDIETPGLAIPLHQGDCYFMLDD
LNATHQHCVLAGSQPRFSSTHRVAECSTGTLDYILQRCQLALQNVCDDVDNDDVSLKSFE
PAVLKQGEEIHNEVEFEWLRQFWFQGNRYRKCTDWWCQPMAQLEALWKKMEGVTNAVLHE
VKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDD
ASMPLPFDLTDIVSELRGQLLEAKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1B0GVH5	0.990	0.894	9.764E-91	559	0.984	0.889	A0A1B0GVH5.pdb.gz	A0A1B0GVH5_HUMAN Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=1
2	AFDB:Q8BGW1	0.978	0.984	4.085E-84	502	0.867	0.873	Q8BGW1.pdb.gz	FTO_MOUSE Alpha-ketoglutarate-dependent dioxygenase FTO OS=Mus musculus OX=10090 GN=Fto PE=1 SV=1
3	PDB:4ie6A	0.871	0.983	3.694E-75	447	0.867	0.980	4ie6A.pdb.gz	Structural basis for inhibition of the fat mass and obesity associated protein (FTO)
4	PDB:5zmdG	0.774	0.966	1.006E-60	403	0.786	0.985	5zmdG.pdb.gz	Structural insights into FTO's catalytic mechanism for the demethylation of multiple RNA substrates.
5	AFDB:A0A2R8PY24	0.873	0.762	2.424E-57	580	0.473	0.412	A0A2R8PY24.pdb.gz
6	AFDB:Q6P6J4	0.287	0.574	7.042E-8	239	0.077	0.163	Q6P6J4.pdb.gz	ALKB2_MOUSE DNA oxidative demethylase ALKBH2 OS=Mus musculus OX=10090 GN=Alkbh2 PE=1 SV=1
7	AFDB:Q9SIE0	0.281	0.432	3.768E-7	314	0.095	0.153	Q9SIE0.pdb.gz	ALKB2_ARATH DNA oxidative demethylase ALKBH2 OS=Arabidopsis thaliana OX=3702 GN=ALKBH2 PE=2 SV=2
8	AFDB:Q6NS38	0.284	0.521	8.075E-7	261	0.085	0.165	Q6NS38.pdb.gz	ALKB2_HUMAN DNA oxidative demethylase ALKBH2 OS=Homo sapiens OX=9606 GN=ALKBH2 PE=1 SV=1
9	AFDB:Q96Q83	0.289	0.486	1.645E-6	286	0.079	0.140	Q96Q83.pdb.gz	ALKB3_HUMAN Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Homo sapiens OX=9606 GN=ALKBH3 PE=1 SV=1
10	AFDB:Q8K1E6	0.288	0.486	2.877E-6	286	0.085	0.150	Q8K1E6.pdb.gz	ALKB3_MOUSE Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 OS=Mus musculus OX=10090 GN=Alkbh3 PE=1 SV=1
11	PDB:2fdjA	0.270	0.596	1.375E-5	207	0.071	0.174	2fdjA.pdb.gz	Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
12	AFDB:P05050	0.290	0.613	1.009E-4	216	0.067	0.157	P05050.pdb.gz	ALKB_ECOLI Alpha-ketoglutarate-dependent dioxygenase AlkB OS=Escherichia coli (strain K12) OX=83333 GN=alkB PE=1 SV=1
13	AFDB:Q86KR9	0.261	0.432	1.175E-4	284	0.059	0.106	Q86KR9.pdb.gz	P4HA_DICDI Prolyl 4-hydroxylase subunit alpha OS=Dictyostelium discoideum OX=44689 GN=phyA PE=1 SV=1
14	PDB:6ku3B	0.297	0.442	1.498E-4	318	0.069	0.110	6ku3B.pdb.gz	A common allosteric mechanism regulates homeostatic inactivation of auxin and gibberellin.
15	PDB:6ie2F	0.153	0.229	2.757E-4	324	0.038	0.059	6ie2F.pdb.gz	Structural basis of nucleic acid recognition and 6mA demethylation by human ALKBH1.
16	PDB:5gjaA	0.253	0.381	4.822E-4	299	0.071	0.120	5gjaA.pdb.gz	Pyrazinamide and derivatives block ethylene biosynthesis by inhibiting ACC oxidase.
17	PDB:6imcD	0.150	0.215	5.617E-4	340	0.059	0.088	6imcD.pdb.gz	Mammalian ALKBH1 serves as an N6-mA demethylase of unpairing DNA.
18	PDB:5o7yA	0.282	0.378	9.824E-4	358	0.063	0.089	5o7yA.pdb.gz
19	PDB:7ekdA	0.278	0.381	1.204E-3	343	0.055	0.082	7ekdA.pdb.gz	Evolutionary alterations in gene expression and enzymatic activities of gibberellin 3-oxidase 1 in Oryza.
20	PDB:1gp6A	0.279	0.379	1.808E-3	349	0.065	0.095	1gp6A.pdb.gz	Structure and Mechanism of Anthocyanidin Synthase from Arabidopsis Thaliana.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GVH5	0.0	1038	559	0.984	0.889	A0A1B0GVH5_HUMAN Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=1
2	Q8BGW1	0.0	898	502	0.867	0.873	FTO_MOUSE Alpha-ketoglutarate-dependent dioxygenase FTO OS=Mus musculus OX=10090 GN=Fto PE=1 SV=1
3	Q9C0B1	0.0	1053	505	1.000	1.000	FTO_HUMAN Alpha-ketoglutarate-dependent dioxygenase FTO OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=3
4	A0A1B0GUY7	1.75e-125	365	173	0.343	1.000	A0A1B0GUY7_HUMAN FTO alpha-ketoglutarate dependent dioxygenase (Fragment) OS=Homo sapiens OX=9606 GN=FTO PE=1 SV=1
5	P07806	0.052	38.9	1104	0.057	0.026	SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAS1 PE=1 SV=2
6	A6M930	1.5	33.9	407	0.051	0.064	A6M930_PIG ATP-dependent RNA helicase OS=Sus scrofa OX=9823 GN=EIF4A2 PE=1 SV=1
7	P10630	1.5	33.9	407	0.051	0.064	IF4A2_MOUSE Eukaryotic initiation factor 4A-II OS=Mus musculus OX=10090 GN=Eif4a2 PE=1 SV=2
8	Q14240	1.5	33.9	407	0.051	0.064	IF4A2_HUMAN Eukaryotic initiation factor 4A-II OS=Homo sapiens OX=9606 GN=EIF4A2 PE=1 SV=2
9	E2RG47	4.9	32.3	826	0.036	0.022	STT3B_CANLF Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Canis lupus familiaris OX=9615 GN=STT3B PE=1 SV=1
10	Q9P2D7	4.9	32.7	4265	0.069	0.008	DYH1_HUMAN Dynein axonemal heavy chain 1 OS=Homo sapiens OX=9606 GN=DNAH1 PE=1 SV=6
11	Q8TCJ2	5.4	32.3	826	0.036	0.022	STT3B_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1
12	O08648	5.7	32.3	1597	0.036	0.011	M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus OX=10090 GN=Map3k4 PE=1 SV=2
13	Q9Y6R4	7.1	32.0	1608	0.036	0.011	M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP3K4 PE=1 SV=2
14	Q80ZG1	9.2	31.2	529	0.042	0.040	RIC8A_RAT Synembryn-A OS=Rattus norvegicus OX=10116 GN=Ric8a PE=1 SV=2
15	P93736	9.5	31.6	1108	0.026	0.012	SYVM1_ARATH Valine--tRNA ligase, mitochondrial 1 OS=Arabidopsis thaliana OX=3702 GN=TWN2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12934 FTO_CTD	1e-54	196.4	FTO C-terminal domain
2	PF12933 FTO_NTD	7.2e-124	424.1	FTO catalytic domain
3	PF09720 Unstab_antitox	5.1e+02	12.1	Putative addiction module component

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418823

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382091	0.979	RNA demethylase ALKBH5
2	9606.ENSP00000373474	0.944	N6-adenosine-methyltransferase non-catalytic subunit
3	9606.ENSP00000299766	0.884	Melanocortin receptor 4
4	9606.ENSP00000351141	0.883	Pre-mRNA-splicing regulator WTAP
5	9606.ENSP00000298717	0.881	N6-adenosine-methyltransferase catalytic subunit
6	9606.ENSP00000216489	0.870	Nucleic acid dioxygenase ALKBH1
7	9606.ENSP00000281017	0.864	Transmembrane protein 18
8	9606.ENSP00000359364	0.852	YTH domain-containing family protein 1
9	9606.ENSP00000362918	0.848	YTH domain-containing family protein 2
10	9606.ENSP00000331608	0.832	Iroquois-class homeodomain protein IRX-3
11	9606.ENSP00000274695	0.820	Threonylcarbamoyladenosine tRNA methylthiotransferase
12	9606.ENSP00000295448	0.805	Glucosamine-6-phosphate deaminase 2
13	9606.ENSP00000358404	0.805	Transcription factor 7-like 2
14	9606.ENSP00000339245	0.790	YTH domain-containing protein 1
15	9606.ENSP00000398181	0.790	DNA oxidative demethylase ALKBH2
16	9606.ENSP00000478490	0.784	YTH domain-containing family protein 3
17	9606.ENSP00000297591	0.783	Protein virilizer homolog
18	9606.ENSP00000350364	0.780	Neuronal growth regulator 1
19	9606.ENSP00000290552	0.769	Iroquois-class homeodomain protein IRX-6
20	9606.ENSP00000394390	0.767	BTB/POZ domain-containing protein KCTD15

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043734	1.000	DNA-N1-methyladenine dioxygenase activity
GO:0005506	1.000	iron ion binding
GO:0035515	1.000	oxidative RNA demethylase activity
GO:0035516	1.000	oxidative DNA demethylase activity
GO:0008198	0.994	ferrous iron binding
GO:0140101	0.985	catalytic activity, acting on a tRNA
GO:0005515	0.934	protein binding
GO:1990931	0.684	mRNA N6-methyladenosine dioxygenase activity
GO:1990984	0.684	tRNA demethylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0008152	0.995	metabolic process
GO:0050789	0.992	regulation of biological process
GO:0044238	0.991	primary metabolic process
GO:1901360	0.989	organic cyclic compound metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0070988	0.985	demethylation
GO:0050794	0.983	regulation of cellular process
GO:0035510	0.975	DNA dealkylation
GO:0050896	0.923	response to stimulus
GO:0009451	0.881	RNA modification
GO:0051716	0.877	cellular response to stimulus
GO:0019222	0.771	regulation of metabolic process
GO:0032879	0.764	regulation of localization
GO:0006950	0.754	response to stress
GO:0060255	0.690	regulation of macromolecule metabolic process
GO:0080090	0.682	regulation of primary metabolic process
GO:0051171	0.672	regulation of nitrogen compound metabolic process
GO:0048518	0.670	positive regulation of biological process
GO:0010883	0.660	regulation of lipid storage
GO:0031323	0.653	regulation of cellular metabolic process
GO:0010468	0.641	regulation of gene expression
GO:0048522	0.635	positive regulation of cellular process
GO:0048523	0.610	negative regulation of cellular process
GO:0006974	0.565	cellular response to DNA damage stimulus
GO:0019219	0.563	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.544	regulation of cellular biosynthetic process
GO:0010556	0.541	regulation of macromolecule biosynthetic process
GO:0051252	0.522	regulation of RNA metabolic process
GO:0031324	0.519	negative regulation of cellular metabolic process
GO:0009893	0.510	positive regulation of metabolic process
GO:0010605	0.480	negative regulation of macromolecule metabolic process
GO:0065008	0.461	regulation of biological quality
GO:0051173	0.460	positive regulation of nitrogen compound metabolic process
GO:0010604	0.458	positive regulation of macromolecule metabolic process
GO:0031325	0.455	positive regulation of cellular metabolic process
GO:0032501	0.399	multicellular organismal process
GO:0051246	0.380	regulation of protein metabolic process
GO:0051172	0.359	negative regulation of nitrogen compound metabolic process
GO:0050793	0.358	regulation of developmental process
GO:0009890	0.341	negative regulation of biosynthetic process
GO:0009894	0.328	regulation of catabolic process
GO:0031327	0.319	negative regulation of cellular biosynthetic process
GO:0031329	0.303	regulation of cellular catabolic process
GO:2000112	0.302	regulation of cellular macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005886	0.997	plasma membrane
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0016604	0.533	nuclear body
GO:0016607	0.503	nuclear speck
GO:0012505	0.312	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:30299	1.000	2-oxoglutarate + a methylated nucleobase within DNA + O2 = a nucleobase within DNA + CO2 + formaldehyde + succinate
EC:1.14.11.33	1.000	DNA oxidative demethylase.
RHEA:49520	0.684	2-oxoglutarate + an N(6)-methyladenosine in mRNA + O2 = an adenosine in mRNA + CO2 + formaldehyde + succinate
EC:1.14.11.53	0.684	mRNA N(6)-methyladenine demethylase.

[back to server]