StarFunc result for job id Q9C0B2

User Input

>input (1584 residues)
MEDDGSLLPEDELLADALLLEDERDELEDPEFDIKCLLQEAEDDVDPGHSSSVKELDTDA
DKLKKKTAEDRTQAFHLRQNLSALDKMHEEQELFTEKMRGELRACRQRRDLIDKQQEAVA
AEIATEEEAGNMAAVGRLQAVSRRLFAELENERDLQSRTEAVLKESENTMWHIEIQEGRL
EAFRTADREEVEATGRRLQVRAAEQLCREQEALGKVERNRLLRIRKSLNTQKELGLRHQK
LLEDARKNHKVAVRFLKASLGRIREQEKKEEMECHEYMRRRMDAVVALKGSISANRDTLR
KFQAWDRAKAELAEQRVQAEKKAILAQGRDAFRHLVHQRRRQELEAQKRAFEEEQKLRKQ
EIISRILKEEAEEEKRKKQHPPTSARHRLTLRDKTWNYISDFCKKTTVPTNTYTLDYEAA
AGPGPSRLLEVVSSELIQGDPGASSEEETLAEPEISGLWNEDYKPYQVPKEDVDRKPVGG
TKMDKDILERTVERLRSRVVHKQVVWGREFQGRPFNSKPELLHFQDFDIGKVYKKKITLV
NTTYTINYCKLVGVEEHLRDFIHVDFDPPGPLSAGMSCEVLVTFKPMINKDLEGNISFLA
QTGEFSVPLKCSTKKCSLSLDKELIDFGSYVVGETTSRTITLTNVGGLGTTFKFLPASEP
CEMDDSQSALKLSSLLTYEDKSLYDKAATSFSEQQLEGTESSQADMQSRKELEKLDKEQE
EEQPAEPERLTTVIPPSEEQTEITLGEVTEGEIGPFSSIKVPIVFTPVVPGDVQARFKVT
FKNPQCPTLHFRVVGVAIDVPVWVPKPSVDLKICMYDRLYQDSVLVHTRSKAALRLKFEV
CKELRAHLELLPKTGYIQAQSSYSVQLKFLPRHSLPEDAGRYFDKETRVLEAPMTIWVAD
QNKPVGFTVHAIVTTSDLELSPSEVDFGYCTIYEAIRTEISLHNHSLLPQEFGFVRLPKF
VDVQPNDGFGTILPLETLQFCVIFQPTKAEEHRFQLTCKSEINRCFKLSCRAVGVHPPLE
LSHYQIKFAATALYDTSVATVYVINSHLSMSSPTHSKPRIGSEDASPMGPTSFEFLLPPD
SPITISPSVGTVWPGKRCLVQVAFRPVLPEKLIRQEALPLLNKEMETKSFRKNMAPQRKD
LHGLSFSVLRAQNRDKLFKVSVPHVLEMRKRELRPSSDEYQAARATLLRAFQAKFDTFVV
PCVVASGDIKDRKGSEPLSFSPHNTLYLELWCPTVAPSVVVTSHKGKTIFNFGDVAVGHR
SIKKISIQNVSPEDLALDFSLLNPNGPFVLLNHSSLLRAGGTQVLVLSFSPHESILAQET
LDIITKRGTLTLTLMGTGVASMITCSIEGSVLNMGYVIAGESVSSGFKLQNNSLLPIKFS
MHLDSLSSTRGRGQQQLPQFLSSPSQRTEVVGTQNLNGQSVFSVAPVKGVMDPGKTQDFT
VTFSPDHESLYFSDKLQVVLFEKKISHQILLKGAACQHMMFVEGGDPLDVPVESLTAIPV
FDPRHREEAEELRPILVTLDYIQFDTDTPAPPATRELQVGCIRTTQPSPKKPDHPLMVSA
LLQLRGDVKETYKVIFVAQVLTGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4P3R7	0.307	0.260	8.789E-101	1940	0.235	0.192	D4P3R7.pdb.gz	CFA74_CHLRE Cilia- and flagella-associated protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP74 PE=1 SV=1
2	PDB:7sqcO0	0.323	0.426	2.711E-84	1140	0.186	0.258	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
3	AFDB:Q388P3	0.332	0.476	6.336E-75	1046	0.126	0.190	Q388P3.pdb.gz	Q388P3_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0270 PE=4 SV=1
4	PDB:7sqcO1	0.147	0.287	2.269E-35	673	0.100	0.236	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
5	AFDB:A0A0A6YWY8	0.115	0.138	1.863E-18	1203	0.082	0.108	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
6	PDB:7q1yA	0.084	0.093	8.409E-18	1374	0.056	0.064	7q1yA.pdb.gz
7	PDB:7q5zA	0.078	0.086	3.075E-17	1344	0.052	0.061	7q5zA.pdb.gz
8	PDB:4lnvA	0.087	0.101	5.060E-16	1276	0.054	0.067	4lnvA.pdb.gz
9	PDB:6h03A	0.080	0.096	6.227E-16	1223	0.060	0.078	6h03A.pdb.gz
10	PDB:7nycA	0.078	0.079	2.053E-15	1542	0.059	0.061	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
11	PDB:5a42A	0.084	0.083	2.660E-15	1597	0.059	0.059	5a42A.pdb.gz
12	PDB:7vonA	0.079	0.086	3.448E-15	1399	0.061	0.069	7vonA.pdb.gz
13	PDB:1e07A	0.112	0.201	1.261E-14	642	0.041	0.101	1e07A.pdb.gz
14	AFDB:A8J6X7	0.099	0.207	5.098E-14	645	0.034	0.084	A8J6X7.pdb.gz	PCDP1_CHLRE Cilia- and flagella-associated protein 221 homolog OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP221 PE=1 SV=1
15	AFDB:Q9HCL0	0.113	0.141	4.995E-13	1135	0.073	0.102	Q9HCL0.pdb.gz	PCD18_HUMAN Protocadherin-18 OS=Homo sapiens OX=9606 GN=PCDH18 PE=1 SV=3
16	AFDB:A0A2R8QME5	0.122	0.155	1.145E-12	1094	0.068	0.099	A0A2R8QME5.pdb.gz	A0A2R8QME5_DANRE Protocadherin 19 OS=Danio rerio OX=7955 GN=fc83e05 PE=1 SV=1
17	AFDB:Q5DTJ9	0.065	0.072	3.068E-12	1315	0.105	0.127	Q5DTJ9.pdb.gz	MYPN_MOUSE Myopalladin OS=Mus musculus OX=10090 GN=Mypn PE=1 SV=2
18	AFDB:F1R2D2	0.117	0.112	3.231E-12	1687	0.059	0.055	F1R2D2.pdb.gz
19	AFDB:Q9W213	0.114	0.125	3.165E-11	1395	0.080	0.090	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
20	AFDB:F1RE66	0.087	0.114	2.976E-8	1134	0.045	0.063	F1RE66.pdb.gz	F1RE66_DANRE Roundabout homolog 4 isoform X1 OS=Danio rerio OX=7955 GN=robo4 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4P3R7	2.69e-87	318	1940	0.127	0.104	CFA74_CHLRE Cilia- and flagella-associated protein 74 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP74 PE=1 SV=1
2	Q388P3	3.92e-14	80.5	1046	0.058	0.088	Q388P3_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0270 PE=4 SV=1
3	A8JFU2	4.27e-07	57.8	2118	0.033	0.025	CFA65_CHLRE Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1
4	Q9Y238	3.00e-04	48.1	1755	0.025	0.023	DLEC1_HUMAN Deleted in lung and esophageal cancer protein 1 OS=Homo sapiens OX=9606 GN=DLEC1 PE=1 SV=2
5	Q6ZU64	6.30e-04	47.4	1925	0.025	0.020	CFA65_HUMAN Cilia- and flagella-associated protein 65 OS=Homo sapiens OX=9606 GN=CFAP65 PE=1 SV=2
6	Q8BLA1	8.29e-04	46.6	635	0.025	0.061	DLEC1_MOUSE Deleted in lung and esophageal cancer protein 1 homolog OS=Mus musculus OX=10090 GN=Dlec1 PE=1 SV=1
7	Q38AM8	0.002	45.8	1794	0.038	0.033	Q38AM8_TRYB2 Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3330 PE=4 SV=1
8	Q4G0P3	0.064	40.8	5121	0.028	0.009	HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3
9	Q80W93	0.16	39.3	5154	0.029	0.009	HYDIN_MOUSE Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2
10	Q4GYI3	2.3	35.4	912	0.039	0.067	Q4GYI3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3940 PE=4 SV=1
11	Q98TZ8	2.8	34.7	428	0.018	0.068	FLOT2_DANRE Flotillin-2a OS=Danio rerio OX=7955 GN=flot2a PE=2 SV=2
12	F1M3G7	6.2	33.9	2760	0.024	0.014	AKP13_RAT A-kinase anchor protein 13 OS=Rattus norvegicus OX=10116 GN=Akap13 PE=1 SV=2
13	Q8CHD8	6.5	33.9	1047	0.031	0.047	RFIP3_MOUSE Rab11 family-interacting protein 3 OS=Mus musculus OX=10090 GN=Rab11fip3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15780 ASH	1e-15	69.0	Abnormal spindle-like microcephaly-assoc'd, ASPM-SPD-2-Hydin
2	PF07610 DUF1573	5.4	18.4	Protein of unknown function (DUF1573)
3	PF00635 Motile_Sperm	0.0074	27.5	MSP (Major sperm protein) domain
4	PF14874 PapD-like	5.1e-05	34.7	Flagellar-associated PapD-like
5	PF07498 Rho_N	2.7e+02	12.9	Rho termination factor, N-terminal domain
6	PF12371 TMEM131_like_N	0.0014	30.1	Transmembrane protein 131-like N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417061

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367848	0.731	Gamma-aminobutyric acid receptor subunit delta
2	9606.ENSP00000311122	0.656	Transmembrane protein 52
3	9606.ENSP00000357575	0.617	Cilia- and flagella-associated protein 46
4	9606.ENSP00000431759	0.615	Cilia- and flagella-associated protein 54
5	9606.ENSP00000454664	0.602	Uncharacterized protein C16orf97
6	9606.ENSP00000287766	0.571	Sodium- and chloride-dependent GABA transporter 1
7	9606.ENSP00000367830	0.538	Protein kinase C zeta type
8	9606.ENSP00000304643	0.536	Calmodulin-like protein 6
9	9606.ENSP00000227349	0.522	Jhy protein homolog
10	9606.ENSP00000393222	0.516	Cilia- and flagella-associated protein 221
11	9606.ENSP00000451145	0.514	Uncharacterized protein
12	9606.ENSP00000301921	0.513	Transcription factor SOX-7
13	9606.ENSP00000335592	0.510	Gamma-aminobutyric acid receptor subunit alpha-5
14	9606.ENSP00000363799	0.507	Actin-like protein 7B
15	9606.ENSP00000306275	0.504	Potassium channel subfamily K member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071840	0.952	cellular component organization or biogenesis
GO:0044085	0.931	cellular component biogenesis
GO:0016043	0.913	cellular component organization
GO:0065007	0.777	biological regulation
GO:0032501	0.753	multicellular organismal process
GO:0032502	0.745	developmental process
GO:0050789	0.672	regulation of biological process
GO:0050794	0.650	regulation of cellular process
GO:0048609	0.643	multicellular organismal reproductive process
GO:0022607	0.620	cellular component assembly
GO:0006996	0.469	organelle organization
GO:0120031	0.458	plasma membrane bounded cell projection assembly
GO:0035082	0.445	axoneme assembly
GO:0007018	0.426	microtubule-based movement
GO:0001539	0.421	cilium or flagellum-dependent cell motility
GO:0003341	0.420	cilium movement
GO:0060285	0.414	cilium-dependent cell motility
GO:0060294	0.403	cilium movement involved in cell motility
GO:0050896	0.356	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005929	0.999	cilium
GO:0005856	0.999	cytoskeleton
GO:0097014	0.955	ciliary plasm
GO:0005930	0.951	axoneme
GO:0016020	0.721	membrane
GO:0005829	0.698	cytosol
GO:0043231	0.622	intracellular membrane-bounded organelle
GO:0071944	0.367	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]