StarFunc result for job id Q9C0B5

User Input

>input (715 residues)
MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLA
NFSMATFMDPGIFPRAEEDEDKEDDFRAPLYKTVEIKGIQVRMKWCATCRFYRPPRCSHC
SVCDNCVEEFDHHCPWVNNCIGRRNYRYFFLFLLSLTAHIMGVFGFGLLYVLYHIEELSG
VRTAVTMAVMCVAGLFFIPVAGLTGFHVVLVARGRTTNEQVTGKFRGGVNPFTNGCCNNV
SRVLCSSPAPRYLGRPKKEKTIVIRPPFLRPEVSDGQITVKIMDNGIQGELRRTKSKGSL
EITESQSADAEPPPPPKPDLSRYTGLRTHLGLATNEDSSLLAKDSPPTPTMYKYRPGYSS
SSTSAAMPHSSSAKLSRGDSLKEPTSIAESSRHPSYRSEPSLEPESFRSPTFGKSFHFDP
LSSGSRSSSLKSAQGTGFELGQLQSIRSEGTTSTSYKSLANQTRNGSLSYDSLLTPSDSP
DFESVQAGPEPDPPLGYTSPFLSARLAQQREAERHPRLVPTGPTHREPSPVRYDNLSRHI
VASLQEREKLLRQSPPLPGREEEPGLGDSGIQSTPGSGHAPRTSSSSDDSKRSPLGKTPL
GRPAVPRFGKPDGLRGRGVGSPEPGPTAPYLGRSMSYSSQKAQPGVSETEEVALQPLLTP
KDEVQLKTTYSKSNGQPKSLGSASPGPGQPPLSSPTRGGVKKVSGVGGTTYEISV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2THW7	0.429	0.429	2.163E-91	715	0.980	0.980	Q2THW7.pdb.gz	ZDHC5_RAT Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus OX=10116 GN=Zdhhc5 PE=1 SV=1
2	AFDB:Q9ULC8	0.410	0.385	4.430E-52	765	0.531	0.497	Q9ULC8.pdb.gz	ZDHC8_HUMAN Palmitoyltransferase ZDHHC8 OS=Homo sapiens OX=9606 GN=ZDHHC8 PE=1 SV=3
3	PDB:6bmsD	0.276	0.667	7.644E-13	282	0.084	0.213	6bmsD.pdb.gz	Fatty acyl recognition and transfer by an integral membraneS-acyltransferase.
4	AFDB:P81408	0.081	0.085	1.814E-2	668	0.154	0.165	P81408.pdb.gz	EREP3_HUMAN Protein ENTREP3 OS=Homo sapiens OX=9606 GN=ENTREP3 PE=1 SV=2
5	AFDB:Q9UQL6	0.057	0.040	2.981E-2	1122	0.138	0.088	Q9UQL6.pdb.gz	HDAC5_HUMAN Histone deacetylase 5 OS=Homo sapiens OX=9606 GN=HDAC5 PE=1 SV=2
6	AFDB:H0ZRP5	0.087	0.058	4.150E-2	1243	0.150	0.086	H0ZRP5.pdb.gz	H0ZRP5_TAEGU Glutamate metabotropic receptor 5 OS=Taeniopygia guttata OX=59729 GN=GRM5 PE=3 SV=2
7	AFDB:Q96PV0	0.073	0.048	1.476E-1	1343	0.158	0.084	Q96PV0.pdb.gz	SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens OX=9606 GN=SYNGAP1 PE=1 SV=4
8	AFDB:A9VAD3	0.069	0.062	3.195E-1	819	0.108	0.094	A9VAD3.pdb.gz	A9VAD3_MONBE Large ribosomal subunit protein uL2 C-terminal domain-containing protein OS=Monosiga brevicollis OX=81824 GN=MONBRDRAFT_34232 PE=1 SV=1
9	AFDB:Q9Y7U0	0.044	0.034	3.769E-1	1184	0.095	0.057	Q9Y7U0.pdb.gz	YCJE_SCHPO Uncharacterized protein C63.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC63.14 PE=1 SV=1
10	AFDB:K8ESM7	0.046	0.038	6.193E-1	955	0.117	0.088	K8ESM7.pdb.gz	K8ESM7_CAEEL RUN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cup-14 PE=1 SV=1
11	AFDB:O48683	0.059	0.074	7.307E-1	540	0.106	0.141	O48683.pdb.gz	O48683_ARATH F3I6.9 protein OS=Arabidopsis thaliana OX=3702 GN=At1g24160 PE=1 SV=1
12	PDB:5d80G	0.081	0.202	1.333	223	0.028	0.090	5d80G.pdb.gz
13	PDB:7o6eA	0.094	0.322	1.488	177	0.042	0.169	7o6eA.pdb.gz
14	PDB:6jp5E	0.061	0.199	1.961	169	0.022	0.095	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
15	PDB:6e2fC	0.085	0.091	2.314	647	0.038	0.042	6e2fC.pdb.gz	Mechanism of calmodulin inactivation of the calcium-selective TRP channel TRPV6.
16	PDB:7eebM	0.070	0.333	2.885	116	0.017	0.103	7eebM.pdb.gz	Structure of a mammalian sperm cation channel complex.
17	PDB:6ez8A	0.043	0.016	3.048	2353	0.021	0.006	6ez8A.pdb.gz
18	PDB:6yejA	0.043	0.017	3.597	2046	0.021	0.007	6yejA.pdb.gz
19	PDB:6iblA	0.062	0.095	4.244	397	0.024	0.043	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
20	PDB:6ov2A	0.062	0.213	4.244	182	0.011	0.044	6ov2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2THW6	0.0	564	762	0.540	0.507	Q2THW6_RAT Palmitoyltransferase OS=Rattus norvegicus OX=10116 GN=Zdhhc8 PE=2 SV=1
2	Q2THW7	0.0	1419	715	0.980	0.980	ZDHC5_RAT Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus OX=10116 GN=Zdhhc5 PE=1 SV=1
3	Q5Y5T5	0.0	560	762	0.544	0.510	ZDHC8_MOUSE Palmitoyltransferase ZDHHC8 OS=Mus musculus OX=10090 GN=Zdhhc8 PE=1 SV=1
4	Q8VDZ4	0.0	1419	715	0.979	0.979	ZDHC5_MOUSE Palmitoyltransferase ZDHHC5 OS=Mus musculus OX=10090 GN=Zdhhc5 PE=1 SV=1
5	Q9C0B5	0.0	1452	715	1.000	1.000	ZDHC5_HUMAN Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2
6	Q9ULC8	0.0	569	765	0.540	0.505	ZDHC8_HUMAN Palmitoyltransferase ZDHHC8 OS=Homo sapiens OX=9606 GN=ZDHHC8 PE=1 SV=3
7	A0A8I6A4S3	5.94e-141	432	733	0.473	0.461	A0A8I6A4S3_RAT Palmitoyltransferase OS=Rattus norvegicus OX=10116 GN=Zdhhc8 PE=3 SV=1
8	Q9Y397	3.37e-60	208	364	0.155	0.305	ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 OS=Homo sapiens OX=9606 GN=ZDHHC9 PE=1 SV=2
9	A2VEY9	3.06e-57	209	693	0.150	0.154	APP_DROME Palmitoyltransferase app OS=Drosophila melanogaster OX=7227 GN=app PE=1 SV=1
10	Q8IZN3	3.18e-54	196	488	0.137	0.201	ZDH14_HUMAN Palmitoyltransferase ZDHHC14 OS=Homo sapiens OX=9606 GN=ZDHHC14 PE=1 SV=1
11	Q9NUE0	2.69e-49	179	388	0.141	0.260	ZDH18_HUMAN Palmitoyltransferase ZDHHC18 OS=Homo sapiens OX=9606 GN=ZDHHC18 PE=1 SV=2
12	Q5Y5T2	9.13e-49	178	380	0.147	0.276	ZDH18_MOUSE Palmitoyltransferase ZDHHC18 OS=Mus musculus OX=10090 GN=Zdhhc18 PE=1 SV=4
13	Q9SB58	1.36e-42	161	407	0.131	0.231	ZDH19_ARATH Protein S-acyltransferase 8 OS=Arabidopsis thaliana OX=3702 GN=PAT08 PE=1 SV=2
14	Q0WQK2	1.37e-40	156	443	0.123	0.199	ZDHC9_ARATH Probable protein S-acyltransferase 7 OS=Arabidopsis thaliana OX=3702 GN=PAT07 PE=1 SV=1
15	Q9M1K5	7.90e-39	152	477	0.124	0.187	ZDH13_ARATH Probable protein S-acyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=PAT04 PE=2 SV=1
16	O74384	1.95e-32	130	350	0.122	0.249	ERFB_SCHPO Palmitoyltransferase erf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=erf2 PE=1 SV=1
17	Q8WVZ1	4.54e-31	125	309	0.112	0.259	ZDH19_HUMAN Palmitoyltransferase ZDHHC19 OS=Homo sapiens OX=9606 GN=ZDHHC19 PE=1 SV=2
18	Q06551	1.26e-26	114	359	0.094	0.187	ERFB_YEAST Palmitoyltransferase ERF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERF2 PE=1 SV=1
19	Q8BGJ0	1.42e-22	101	337	0.080	0.169	ZDH15_MOUSE Palmitoyltransferase ZDHHC15 OS=Mus musculus OX=10090 GN=Zdhhc15 PE=1 SV=1
20	Q2TGJ4	1.68e-22	101	337	0.080	0.169	ZDH15_RAT Palmitoyltransferase ZDHHC15 OS=Rattus norvegicus OX=10116 GN=Zdhhc15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01529 DHHC	4.1e-32	122.5	DHHC palmitoyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287169

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364013	0.837	Tomoregulin-1
2	9606.ENSP00000359634	0.816	Golgin subfamily A member 7B
3	9606.ENSP00000421226	0.790	Claudin domain containing 1
4	9606.ENSP00000382428	0.779	Disks large homolog 4
5	9606.ENSP00000350378	0.708	Golgin subfamily A member 7
6	9606.ENSP00000378368	0.702	Flotillin-2
7	9606.ENSP00000262507	0.695	Ubiquinone biosynthesis protein COQ9, mitochondrial
8	9606.ENSP00000316176	0.655	Ubiquitin-conjugating enzyme E2 N
9	9606.ENSP00000367265	0.626	Cytoskeleton-associated protein 4
10	9606.ENSP00000313172	0.598	Blood vessel epicardial substance
11	9606.ENSP00000328174	0.592	ATP-dependent DNA helicase PIF1
12	9606.ENSP00000254286	0.564	Actin related protein 10 homolog
13	9606.ENSP00000293897	0.562	Somatostatin receptor type 5
14	9606.ENSP00000258301	0.561	Syntaxin-6
15	9606.ENSP00000481244	0.543	Phospholemman
16	9606.ENSP00000318222	0.538	Palmitoyltransferase ZDHHC22
17	9606.ENSP00000394863	0.528	Palmitoyl-protein thioesterase 1
18	9606.ENSP00000365569	0.527	Flotillin-1
19	9606.ENSP00000346671	0.524	Tyrosine-protein kinase Fyn
20	9606.ENSP00000282388	0.507	mRNA decay activator protein ZFP36L2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016409	1.000	palmitoyltransferase activity
GO:0019706	0.978	protein-cysteine S-palmitoyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0009987	0.990	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0044237	0.983	cellular metabolic process
GO:0043412	0.981	macromolecule modification
GO:0044238	0.979	primary metabolic process
GO:0018345	0.966	protein palmitoylation
GO:0048518	0.961	positive regulation of biological process
GO:0048522	0.952	positive regulation of cellular process
GO:0048583	0.889	regulation of response to stimulus
GO:1905475	0.889	regulation of protein localization to membrane
GO:1904375	0.884	regulation of protein localization to cell periphery
GO:0002682	0.837	regulation of immune system process
GO:0023051	0.778	regulation of signaling
GO:0010646	0.765	regulation of cell communication
GO:1903829	0.740	positive regulation of protein localization
GO:0050776	0.732	regulation of immune response
GO:0031347	0.732	regulation of defense response
GO:0002831	0.713	regulation of response to biotic stimulus
GO:1903076	0.703	regulation of protein localization to plasma membrane
GO:0032101	0.687	regulation of response to external stimulus
GO:1904377	0.604	positive regulation of protein localization to cell periphery
GO:0009966	0.439	regulation of signal transduction
GO:0009967	0.434	positive regulation of signal transduction
GO:1905477	0.422	positive regulation of protein localization to membrane
GO:1903078	0.405	positive regulation of protein localization to plasma membrane
GO:0002684	0.371	positive regulation of immune system process
GO:0045088	0.371	regulation of innate immune response
GO:0045089	0.346	positive regulation of innate immune response
GO:0062207	0.334	regulation of pattern recognition receptor signaling pathway
GO:0065008	0.320	regulation of biological quality
GO:0062208	0.313	positive regulation of pattern recognition receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0031982	0.998	vesicle
GO:0005886	0.997	plasma membrane
GO:0031410	0.987	cytoplasmic vesicle
GO:0030054	0.986	cell junction
GO:0043232	0.984	intracellular non-membrane-bounded organelle
GO:0042995	0.960	cell projection
GO:0120025	0.954	plasma membrane bounded cell projection
GO:0031090	0.949	organelle membrane
GO:0005829	0.942	cytosol
GO:0045202	0.887	synapse
GO:0036477	0.839	somatodendritic compartment
GO:0098588	0.828	bounding membrane of organelle
GO:0043005	0.827	neuron projection
GO:0097447	0.769	dendritic tree
GO:0005794	0.759	Golgi apparatus
GO:0030139	0.756	endocytic vesicle
GO:0030425	0.751	dendrite
GO:0045335	0.699	phagocytic vesicle
GO:0005576	0.450	extracellular region
GO:0012506	0.448	vesicle membrane
GO:0030659	0.440	cytoplasmic vesicle membrane
GO:0043230	0.418	extracellular organelle
GO:0065010	0.404	extracellular membrane-bounded organelle
GO:0098794	0.397	postsynapse
GO:0005615	0.380	extracellular space
GO:0070013	0.357	intracellular organelle lumen
GO:0070062	0.357	extracellular exosome
GO:0000139	0.347	Golgi membrane
GO:0005654	0.321	nucleoplasm
GO:0099572	0.310	postsynaptic specialization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.
RHEA:36683	0.978	hexadecanoyl-CoA + L-cysteinyl-[protein] = CoA + S-hexadecanoyl-L-cysteinyl-[protein]
EC:2.3.1.225	0.978	protein S-acyltransferase.

[back to server]