StarFunc result for job id Q9C0B7

User Input

>input (1094 residues)
MAARQAVGSGAQETCGLDRILEALKLLLSPGGSGSSSLQVTKHDVLLATLKSNLSALEDK
FLKDPQWKNLKLLRDEIADKAEWPQNSVDVTWSFTSQTLLLLLCLKETMIRLAANFNPGK
PNPRTPEVAPALSPDALSISQQKTVQFVLQFVVTLGICPYLMPGVGVPLRYRTEFGAVVQ
DVVCFDAAPDATRRLYTSCKALLNVAQHTSLGSLIFCHHFGDIAAGLCQLGFCPTKRKLL
TPAEEVLTEEERTLSRGALRDMLDQVYQPLAVRELLILQGGPPQSCTDVKTQMRCRAPAW
LRRLCGQLLSERLMRPNGVQAVVRGILEGAGAGAAGGSDAEVTAADWKKCDLIAKILASC
PQQSLSPENYYRDICPQVLDLFHFQDKLTARQFQRVATTTFITLSRERPHLAAKYLLQPV
LAPLHRCLNTAELSESDMVPGTILVTEEELSRCIEDVFKVYVVGNEPLTVLMDSLLPVLG
VLFLLYCFTKQSVSHIRSLCQEILLWILGKLERKKAIASLKGFAGLDKAVPSLHSLCQFR
VATQGGIMITIKEAISDEDEDEALYQKVSSEQGRVEHLGDLLSHCQECGLAGDFFIFCLK
ELTHVASENETELKTEPFSSKSLLELEQHQTLLVEGQERKLLVLQLMAVLCERMSEQIFT
NVTQVVDFVAATLQRACASLAHQAESTVESQTLSMSMGLVAVMLGGAVQLKSSDFAVLKQ
LLPLLEKVSNTYPDPVIQELAVDLRITISTHGAFATEAVSMAAQSTLNRKDLEGKIEEQQ
QTSHERPTDVAHSHLEQQQSHETAPQTGLQSNAPIIPQGVNEPSTTTSQKSGSVTTEQLQ
EVLLSAYDPQIPTRAAALRTLSHWIEQREAKALEMQEKLLKIFLENLEHEDTFVYLSAIQ
GVALLSDVYPEKILPDLLAQYDSSKDKHTPETRMKVGEVLMRIVRALGDMVSKYREPLIH
TFLRGVRDPDGAHRASSLANLGELCQRLDFLLGSVVHEVTACLIAVAKTDGEVQVRRAAI
HVVVLLLRGLSQKATEVLSAVLKDLYHLLKHVVCLEPDDVAKLHAQLALEELDDIMKNFL
FPPQKLEKKIMVLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VJ29	0.436	0.508	5.928E-24	921	0.161	0.191	Q9VJ29.pdb.gz	TNG6_DROME Transport and Golgi organization protein 6 OS=Drosophila melanogaster OX=7227 GN=Tango6 PE=2 SV=1
2	AFDB:Q12751	0.384	0.421	2.679E-18	981	0.161	0.179	Q12751.pdb.gz	RTP1_YEAST RNA polymerase II assembly factor RTP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTP1 PE=1 SV=1
3	AFDB:O42977	0.335	0.468	8.873E-17	747	0.140	0.205	O42977.pdb.gz	RTP1_SCHPO RNA polymerase II assembly factor rtp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rtp1 PE=3 SV=1
4	AFDB:I1HCQ1	0.153	0.148	1.014E-8	1155	0.140	0.132	I1HCQ1.pdb.gz	I1HCQ1_BRADI Gigantea OS=Brachypodium distachyon OX=15368 GN=100822621 PE=4 SV=1
5	AFDB:Q9Y4R8	0.200	0.257	1.270E-8	837	0.123	0.161	Q9Y4R8.pdb.gz	TELO2_HUMAN Telomere length regulation protein TEL2 homolog OS=Homo sapiens OX=9606 GN=TELO2 PE=1 SV=2
6	AFDB:G5EEQ8	0.172	0.146	1.370E-8	1322	0.103	0.085	G5EEQ8.pdb.gz	G5EEQ8_CAEEL Splicing factor 3B subunit 1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sftb-1 PE=1 SV=1
7	AFDB:P49955	0.162	0.180	1.477E-8	971	0.101	0.114	P49955.pdb.gz	SF3B1_YEAST U2 snRNP component HSH155 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSH155 PE=1 SV=1
8	AFDB:Q9SQI2	0.154	0.146	1.851E-8	1173	0.134	0.125	Q9SQI2.pdb.gz	GIGAN_ARATH Protein GIGANTEA OS=Arabidopsis thaliana OX=3702 GN=GI PE=1 SV=2
9	AFDB:Q9FMF9	0.181	0.158	3.380E-8	1269	0.124	0.107	Q9FMF9.pdb.gz	Q9FMF9_ARATH Nuclear protein-like OS=Arabidopsis thaliana OX=3702 GN=MSJ1.11 PE=1 SV=1
10	PDB:7unkA	0.144	0.149	3.754E-8	1047	0.126	0.132	7unkA.pdb.gz
11	AFDB:F1QQZ1	0.174	0.147	4.080E-8	1315	0.101	0.084	F1QQZ1.pdb.gz	F1QQZ1_DANRE Splicing factor 3B subunit 1 isoform X1 OS=Danio rerio OX=7955 GN=sf3b1 PE=1 SV=2
12	PDB:6ahd1	0.181	0.188	2.201E-7	1048	0.101	0.106	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
13	PDB:4a0cA	0.161	0.154	2.657E-7	1155	0.107	0.101	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
14	PDB:6xu2A	0.155	0.157	3.728E-7	1091	0.128	0.128	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
15	PDB:4jlqA	0.163	0.193	8.533E-7	840	0.110	0.143	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:6tc0C	0.163	0.177	1.243E-6	994	0.113	0.125	6tc0C.pdb.gz
17	PDB:3nd2A	0.164	0.202	2.357E-6	861	0.112	0.143	3nd2A.pdb.gz
18	PDB:7mqaSP	0.188	0.088	2.740E-6	2485	0.131	0.058	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7wttK	0.170	0.180	2.740E-6	1022	0.101	0.108	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
20	PDB:3w3uA	0.155	0.161	3.068E-6	1030	0.120	0.127	3w3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9VJ29	2.32e-13	77.0	921	0.051	0.061	TNG6_DROME Transport and Golgi organization protein 6 OS=Drosophila melanogaster OX=7227 GN=Tango6 PE=2 SV=1
2	Q12751	4.50e-12	73.2	981	0.051	0.057	RTP1_YEAST RNA polymerase II assembly factor RTP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTP1 PE=1 SV=1
3	O42977	1.70e-04	48.1	747	0.036	0.052	RTP1_SCHPO RNA polymerase II assembly factor rtp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rtp1 PE=3 SV=1
4	Q8TEX9	0.036	40.8	1081	0.035	0.035	IPO4_HUMAN Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2
5	Q7TSH8	0.42	37.4	1360	0.024	0.019	TMM94_MOUSE Transmembrane protein 94 OS=Mus musculus OX=10090 GN=Tmem94 PE=1 SV=1
6	Q5ADN1	0.45	37.0	643	0.046	0.078	Q5ADN1_CANAL Protein phosphatase 2A structural subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TPD3 PE=4 SV=1
7	Q8VI75	0.97	36.2	1082	0.027	0.027	IPO4_MOUSE Importin-4 OS=Mus musculus OX=10090 GN=Ipo4 PE=1 SV=1
8	Q9Y7K2	1.6	35.4	2337	0.045	0.021	TOR2_SCHPO Serine/threonine-protein kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tor2 PE=1 SV=2
9	Q382Q5	1.7	34.7	260	0.019	0.081	Q382Q5_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4610 PE=4 SV=1
10	P35169	2.3	35.0	2470	0.036	0.016	TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOR1 PE=1 SV=3
11	Q86C65	3.8	34.3	2380	0.042	0.019	TOR_DICDI Serine/threonine-protein kinase tor OS=Dictyostelium discoideum OX=44689 GN=tor PE=1 SV=1
12	Q382T3	5.3	33.5	637	0.017	0.030	Q382T3_TRYB2 Serine/threonine-protein phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4320 PE=3 SV=1
13	Q9JIR1	6.2	33.5	1049	0.025	0.026	RIMB2_RAT RIMS-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Rimbp2 PE=1 SV=2
14	P25348	6.4	32.3	183	0.017	0.104	RM32_YEAST Large ribosomal subunit protein bL32m OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRPL32 PE=1 SV=1
15	D7PHZ6	6.6	33.1	520	0.034	0.071	VRTE_PENAE Cytochrome P450 monooxygenase vrtE OS=Penicillium aethiopicum OX=36650 GN=vrtE PE=1 SV=1
16	Q8LDU4	7.1	32.7	319	0.025	0.085	RCCR_ARATH Red chlorophyll catabolite reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RCCR PE=1 SV=2
17	Q922J3	7.6	33.1	1391	0.036	0.028	CLIP1_MOUSE CAP-Gly domain-containing linker protein 1 OS=Mus musculus OX=10090 GN=Clip1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02985 HEAT	0.2	23.0	HEAT repeat
2	PF13646 HEAT_2	0.098	24.4	HEAT repeats
3	PF13513 HEAT_EZ	27	16.7	HEAT-like repeat
4	PF10363 RTP1_C1	1.9e-29	113.4	Required for nuclear transport of RNA pol II C-terminus 1
5	PF10304 RTP1_C2	4.9e-07	40.6	Required for nuclear transport of RNA pol II C-terminus 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261778

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361852	0.835	Transmembrane and coiled-coil domains 2
2	9606.ENSP00000335636	0.788	N-alpha-acetyltransferase 20
3	9606.ENSP00000362946	0.785	Ras-related protein Rab-14
4	9606.ENSP00000381198	0.778	LisH domain and HEAT repeat-containing protein KIAA1468
5	9606.ENSP00000434466	0.771	Integrator complex subunit 4
6	9606.ENSP00000450444	0.770	HEAT repeat-containing protein 4
7	9606.ENSP00000216036	0.768	Radial spoke head 14 homolog
8	9606.ENSP00000327234	0.768	Transmembrane and coiled-coil domains 5A
9	9606.ENSP00000354573	0.763	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
10	9606.ENSP00000480514	0.747	Calcium load-activated calcium channel
11	9606.ENSP00000184956	0.731	HEAT repeat-containing protein 6
12	9606.ENSP00000301972	0.729	Rab effector MyRIP
13	9606.ENSP00000295709	0.685	Serine/threonine-protein kinase 36
14	9606.ENSP00000297440	0.666	Dynein assembly factor 5, axonemal
15	9606.ENSP00000312767	0.662	CEP295 N-terminal-like protein
16	9606.ENSP00000339179	0.580	Testis-specific serine/threonine-protein kinase 4
17	9606.ENSP00000360252	0.576	Protein Hook homolog 1
18	9606.ENSP00000386331	0.532	Unconventional myosin-VIIa
19	9606.ENSP00000327179	0.531	U3 small nucleolar RNA-associated protein 4 homolog
20	9606.ENSP00000379531	0.529	Transmembrane channel-like protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.328	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.529	biological regulation
GO:0051179	0.524	localization
GO:0050789	0.523	regulation of biological process
GO:0051641	0.459	cellular localization
GO:0050794	0.353	regulation of cellular process
GO:0071840	0.332	cellular component organization or biogenesis
GO:0016043	0.318	cellular component organization
GO:0033036	0.306	macromolecule localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0032991	0.976	protein-containing complex
GO:0005654	0.975	nucleoplasm
GO:0005829	0.958	cytosol
GO:0043228	0.747	non-membrane-bounded organelle
GO:0043232	0.728	intracellular non-membrane-bounded organelle
GO:0012505	0.348	endomembrane system
GO:0140535	0.332	intracellular protein-containing complex
GO:0016020	0.325	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]