StarFunc result for job id Q9C0B9

User Input

>input (1178 residues)
MLRMKLPLKPTHPAEPPPEAEEPEADARPGAKAPSRRRRDCRPPPPPPPPAGPSRGPLPP
PPPPRGLGPPVAGGAAAGAGMPGGGGGPSAALREQERVYEWFGLVLGSAQRLEFMCGLLD
LCNPLELRFLGSCLEDLARKDYHYLRDSEAKANGLSDPGPLADFREPAVRSRLIVYLALL
GSENREAAGRLHRLLPQVDSVLKSLRAARGEGSRGGAEDERGEDGDGEQDAEKDGSGPEG
GIVEPRVGGGLGSRAQEELLLLFTMASLHPAFSFHQRVTLREHLERLRAALRGGPEDAEV
EVEPCKFAGPRAQNNSAHGDYMQNNESSLIEQAPIPQDGLTVAPHRAQREAVHIEKIMLK
GVQRKRADKYWEYTFKVNWSDLSVTTVTKTHQELQEFLLKLPKELSSETFDKTILRALNQ
GSLKREERRHPDLEPILRQLFSSSSQAFLQSQKVHSFFQSISSDSLHSINNLQSSLKTSK
ILEHLKEDSSEASSQEEDVLQHAIIHKKHTGKSPIVNNIGTSCSPLDGLTMQYSEQNGIV
DWRKQSCTTIQHPEHCVTSADQHSAEKRSLSSINKKKGKPQTEKEKIKKTDNRLNSRING
IRLSTPQHAHGGTVKDVNLDIGSGHDTCGETSSESYSSPSSPRHDGRESFESEEEKDRDT
DSNSEDSGNPSTTRFTGYGSVNQTVTVKPPVQIASLGNENGNLLEDPLNSPKYQHISFMP
TLHCVMHNGAQKSEVVVPAPKPADGKTIGMLVPSPVAISAIRESANSTPVGILGPTACTG
ESEKHLELLASPLPIPSTFLPHSSTPALHLTVQRLKLPPPQGSSESCTVNIPQQPPGSLS
IASPNTAFIPIHNPGSFPGSPVATTDPITKSASQVVGLNQMVPQIEGNTGTVPQPTNVKV
VLPAAGLSAAQPPASYPLPGSPLAAGVLPSQNSSVLSTAATSPQPASAGISQAQATVPPA
VPTHTPGPAPSPSPALTHSTAQSDSTSYISAVGNTNANGTVVPPQQMGSGPCGSCGRRCS
CGTNGNLQLNSYYYPNPMPGPMYRVPSFFTLPSICNGSYLNQAHQSNGNQLPFFLPQTPY
ANGLVHDPVMGSQANYGMQQMAGFGRFYPVYPAPNVVANTSGSGPKKNGNVSCYNCGVSG
HYAQDCKQSSMEANQQGTYRLRYAPPLPPSNDTLDSAD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0B9	1.000	1.000	0.000	1178	1.000	1.000	Q9C0B9.pdb.gz	ZCHC2_HUMAN Zinc finger CCHC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZCCHC2 PE=1 SV=6
2	AFDB:Q8WYQ9	0.100	0.122	8.675E-19	949	0.190	0.236	Q8WYQ9.pdb.gz	ZCH14_HUMAN Zinc finger CCHC domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZCCHC14 PE=1 SV=1
3	AFDB:Q5T5P2	0.052	0.038	4.392E-4	1943	0.164	0.099	Q5T5P2.pdb.gz	SKT_HUMAN Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2
4	AFDB:O94913	0.041	0.032	9.018E-3	1555	0.157	0.119	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
5	PDB:2dybA	0.062	0.207	2.912E-2	298	0.014	0.057	2dybA.pdb.gz
6	AFDB:P35658	0.035	0.024	3.416E-2	2090	0.179	0.101	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
7	AFDB:Q55GE6	0.047	0.028	4.413E-2	2615	0.138	0.062	Q55GE6.pdb.gz	ROCO7_DICDI Probable serine/threonine-protein kinase roco7 OS=Dictyostelium discoideum OX=44689 GN=roco7 PE=3 SV=1
8	AFDB:O00512	0.055	0.048	4.889E-2	1426	0.177	0.146	O00512.pdb.gz	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4
9	AFDB:B7YZK8	0.057	0.047	6.648E-2	1517	0.137	0.106	B7YZK8.pdb.gz	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
10	AFDB:F4I1T7	0.039	0.029	8.160E-2	1819	0.160	0.104	F4I1T7.pdb.gz	NP214_ARATH Nuclear pore complex protein NUP214 OS=Arabidopsis thaliana OX=3702 GN=NUP214 PE=1 SV=1
11	AFDB:P25653	0.037	0.029	8.160E-2	1609	0.115	0.084	P25653.pdb.gz	FIG2_YEAST Factor-induced gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FIG2 PE=1 SV=2
12	PDB:2mxcA	0.072	0.347	2.635E-1	172	0.017	0.116	2mxcA.pdb.gz
13	PDB:1vhzA	0.029	0.156	3.583E-1	186	0.003	0.022	1vhzA.pdb.gz	Structural analysis of a set of proteins resulting from a bacterial genomics project
14	PDB:7czeB	0.045	0.273	4.178E-1	109	0.018	0.193	7czeB.pdb.gz
15	PDB:3r11B	0.031	0.082	7.726E-1	364	0.009	0.030	3r11B.pdb.gz	Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
16	PDB:4rhrB	0.035	0.220	8.132E-1	115	0.008	0.087	4rhrB.pdb.gz
17	PDB:4mggA	0.031	0.082	8.559E-1	369	0.008	0.024	4mggA.pdb.gz	Crystal structure of an enolase (mandelate racemase subgroup) from labrenzia aggregata iam 12614 (target nysgrc-012903) with bound mg, space group p212121
18	PDB:5lmxB	0.036	0.037	9.009E-1	1115	0.014	0.014	5lmxB.pdb.gz	The dynamic assembly of distinct RNA polymerase I complexes modulates rDNA transcription.
19	PDB:1lc3A	0.032	0.091	9.981E-1	292	0.008	0.031	1lc3A.pdb.gz	Crystal structure of a biliverdin IXalpha reductase enzyme-cofactor complex.
20	PDB:4a2iL	0.027	0.188	9.981E-1	123	0.006	0.057	4a2iL.pdb.gz	Cryo-Electron Microscopy Structure of the 30S Subunit in Complex with the Yjeq Biogenesis Factor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C0B9	0.0	2409	1178	1.000	1.000	ZCHC2_HUMAN Zinc finger CCHC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZCCHC2 PE=1 SV=6
2	Q8WYQ9	7.06e-22	105	949	0.047	0.058	ZCH14_HUMAN Zinc finger CCHC domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZCCHC14 PE=1 SV=1
3	O14776	0.17	38.5	1098	0.047	0.050	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
4	Q9VLS7	3.2	34.7	2016	0.020	0.012	Q9VLS7_DROME LD21067p OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
5	X2JDJ3	3.3	34.7	2015	0.020	0.012	X2JDJ3_DROME Phosphatidic acid phospholipase A1, isoform D OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=1 SV=1
6	Q38896	3.8	33.1	201	0.009	0.055	CSP4_ARATH Cold shock domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=CSP4 PE=1 SV=1
7	Q8CGF7	4.3	33.9	1100	0.028	0.030	TCRG1_MOUSE Transcription elongation regulator 1 OS=Mus musculus OX=10090 GN=Tcerg1 PE=1 SV=2
8	Q7SZZ4	5.8	33.5	1229	0.051	0.049	Q7SZZ4_DANRE Period 1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=3
9	A0A0R4ICG0	6.5	33.5	1387	0.051	0.043	A0A0R4ICG0_DANRE Period 1 isoform X1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=1
10	Q8MQQ8	8.5	33.1	1332	0.020	0.018	Q8MQQ8_DROME LD21041p (Fragment) OS=Drosophila melanogaster OX=7227 GN=PAPLA1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	0.012	26.9	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269499

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381198	0.746	LisH domain and HEAT repeat-containing protein KIAA1468
2	9606.ENSP00000485614	0.673	Zinc finger protein 518A
3	9606.ENSP00000396995	0.668	Non-canonical poly(A) RNA polymerase PAPD5
4	9606.ENSP00000369604	0.630	F-box only protein 16
5	9606.ENSP00000372955	0.626	Embryonic stem cell-specific 5-hydroxymethylcytosine-binding protein
6	9606.ENSP00000362993	0.614	Protein bicaudal C homolog 1
7	9606.ENSP00000320757	0.612	Modulator of macroautophagy TMEM150B
8	9606.ENSP00000295777	0.608	Neuroserpin
9	9606.ENSP00000273962	0.598	tRNA methyltransferase 10 homolog A
10	9606.ENSP00000296792	0.594	U3 small nucleolar RNA-associated protein 15 homolog
11	9606.ENSP00000362550	0.578	Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1
12	9606.ENSP00000230859	0.576	Non-canonical poly(A) RNA polymerase PAPD7
13	9606.ENSP00000354040	0.560	Nucleolar GTP-binding protein 1
14	9606.ENSP00000303434	0.557	Ubiquitin carboxyl-terminal hydrolase 38
15	9606.ENSP00000362153	0.548	Nucleolar GTP-binding protein 2
16	9606.ENSP00000369320	0.538	Retinoschisin
17	9606.ENSP00000478754	0.536	Probable ATP-dependent RNA helicase DDX6
18	9606.ENSP00000353512	0.530	Poly [ADP-ribose] polymerase 9
19	9606.ENSP00000376767	0.529	Uncharacterized protein NKAPD1
20	9606.ENSP00000435460	0.502	Galectin 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.388	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.970	biological regulation
GO:0009987	0.910	cellular process
GO:0050789	0.882	regulation of biological process
GO:0050794	0.779	regulation of cellular process
GO:0008152	0.772	metabolic process
GO:0071704	0.725	organic substance metabolic process
GO:0044238	0.590	primary metabolic process
GO:0043170	0.574	macromolecule metabolic process
GO:0006807	0.570	nitrogen compound metabolic process
GO:0050896	0.532	response to stimulus
GO:0019222	0.451	regulation of metabolic process
GO:0060255	0.415	regulation of macromolecule metabolic process
GO:0051171	0.388	regulation of nitrogen compound metabolic process
GO:0080090	0.387	regulation of primary metabolic process
GO:0031323	0.385	regulation of cellular metabolic process
GO:0044237	0.378	cellular metabolic process
GO:0048519	0.343	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.959	intracellular membrane-bounded organelle
GO:0070013	0.945	intracellular organelle lumen
GO:0005634	0.940	nucleus
GO:0031981	0.820	nuclear lumen
GO:0005654	0.627	nucleoplasm
GO:0005829	0.507	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]