StarFunc result for job id Q9C0C2

User Input

>input (1729 residues)
MKVSTLRESSAMASPLPREMEEELVPTGSEPGDTRAKPPVKPKPRALPAKPALPAKPSLL
VPVGPRPPRGPLAELPSARKMNMLAGPQPYGGSKRPLPFAPRPAVEASTGGEATQETGKE
EAGKEEPPPLTPPARCAAPGGVRKAPAPFRPASERFAATTVEEILAKMEQPRKEVLASPD
RLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTP
EERSLPSDLAFNGDLAKAASSELPADISKPWIPSSPAPSSENGGPASPGLPAEASGSGPG
SPHLHPPDKSSPCHSQLLEAQTPEASQASPCPAVTPSAPSAALPDEGSRHTPSPGLPAEG
APEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDLTRTFPSGGEEEAKGDAHLRP
TSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLALDRPFGAESNWSLSQSFEWTF
PTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGS
SWVQGDDPSMSLTQKGDGESQPQFPAVPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQE
SPLPLATREAALPILEPVLGQEQPAAPDQPCVLFADAPEPGQALPVEEEAVTLARAETTQ
ARTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGAELKDTQSPSTCSEGL
LGWSQKDLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPRGDPGLGERDWTSKYGQ
GAGEGSTREWASRCGIGQEEMEASSSQDQSKVSAPGVLTAQDRVVGKPAQLGTQRSQEAD
VQDWEFRKRDSQGTYSSRDAELQDQEFGKRDSLGTYSSRDVSLGDWEFGKRDSLGAYASQ
DANEQGQDLGKRDHHGRYSSQDADEQDWEFQKRDVSLGTYGSRAAEPQEQEFGKSAWIRD
YSSGGSSRTLDAQDRSFGTRPLSSGFSPEEAQQQDEEFEKKIPSVEDSLGEGSRDAGRPG
ERGSGGLFSPSTAHVPDGALGQRDQSSWQNSDASQEVGGHQERQQAGAQGPGSADLEDGE
MGKRGWVGEFSLSVGPQREAAFSPGQQDWSRDFCIEASERSYQFGIIGNDRVSGAGFSPS
SKMEGGHFVPPGKTTAGSVDWTDQLGLRNLEVSSCVGSGGSSEARESAVGQMGWSGGLSL
RDMNLTGCLESGGSEEPGGIGVGEKDWTSDVNVKSKDLAEVGEGGGHSQARESGVGQTDW
SGVEAGEFLKSRERGVGQADWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDL
EVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEAREHGVGGVSQCPEPGLRH
NGSLSPGLEARDPLEARELGVGETSGPETQGEDYSSSSLEPHPADPGMETGEALSFGASP
GRCPARPPPSGSQGLLEEMLAASSSKAVARRESAASGLGGLLEEEGAGAGAAQEEVLEPG
RDSPPSWRPQPDGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFI
EDTEILDSAMYRSRANLGRKRGHRAPVIRPGGTLGLSEAADSDAHLFQDSTEPRASRVPS
SDEEVVEEPQSRRTRMSLGTKGLKVNLFPGLSPSALKAKLRPRNRSAEEGELAESKSSQK
ESAVQRSKSCKVPGLGKPLTLPPKPEKSSGSEGSSPNWLQALKLKKKKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0C2	1.000	1.000	0.000	1729	1.000	1.000	Q9C0C2.pdb.gz	TB182_HUMAN 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4
2	AFDB:Q5TGY3	0.030	0.032	9.638E-4	1603	0.166	0.179	Q5TGY3.pdb.gz	AHDC1_HUMAN Transcription factor Gibbin OS=Homo sapiens OX=9606 GN=AHDC1 PE=1 SV=1
3	AFDB:Q61602	0.029	0.030	1.547E-2	1583	0.152	0.166	Q61602.pdb.gz	GLI3_MOUSE Transcriptional activator GLI3 OS=Mus musculus OX=10090 GN=Gli3 PE=1 SV=2
4	AFDB:Q9W1X4	0.031	0.031	2.845E-2	1711	0.110	0.112	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
5	AFDB:Q9Z1Q1	0.032	0.031	3.258E-2	1818	0.188	0.179	Q9Z1Q1.pdb.gz	NEST_MESAU Nestin (Fragments) OS=Mesocricetus auratus OX=10036 GN=NES PE=1 SV=2
6	AFDB:Q80TN7	0.032	0.029	6.861E-2	2359	0.153	0.112	Q80TN7.pdb.gz	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2
7	AFDB:Q9W2E1	0.030	0.028	6.861E-2	1870	0.167	0.155	Q9W2E1.pdb.gz	STUM_DROME Protein stum OS=Drosophila melanogaster OX=7227 GN=stum PE=2 SV=3
8	AFDB:Q9IA31	0.031	0.034	8.406E-2	1544	0.134	0.150	Q9IA31.pdb.gz	GLI3_CHICK Transcriptional activator GLI3 (Fragment) OS=Gallus gallus OX=9031 GN=GLI3 PE=1 SV=1
9	AFDB:Q6DRQ0	0.022	0.036	1.546E-1	925	0.075	0.141	Q6DRQ0.pdb.gz
10	AFDB:F1LR12	0.038	0.030	2.843E-1	2425	0.168	0.120	F1LR12.pdb.gz	F1LR12_RAT Neuron navigator 2 OS=Rattus norvegicus OX=10116 GN=Nav2 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R542	0.0	3402	1729	1.000	1.000	A0A024R542_HUMAN Testis secretory sperm-binding protein Li 206a OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q9C0C2	0.0	3402	1729	1.000	1.000	TB182_HUMAN 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4
3	A0A8I6AMP4	0.59	37.0	461	0.024	0.091	A0A8I6AMP4_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfic PE=1 SV=1
4	O70188	0.61	37.0	439	0.024	0.096	O70188_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfic PE=1 SV=2
5	P70255	0.77	36.6	439	0.024	0.093	NFIC_MOUSE Nuclear factor 1 C-type OS=Mus musculus OX=10090 GN=Nfic PE=1 SV=1
6	A0A8I5ZYT8	1.0	36.6	511	0.024	0.082	A0A8I5ZYT8_RAT Nuclear factor 1 OS=Rattus norvegicus OX=10116 GN=Nfic PE=1 SV=1
7	P0C5W1	2.0	35.8	972	0.020	0.036	MAP1S_RAT Microtubule-associated protein 1S OS=Rattus norvegicus OX=10116 GN=Map1s PE=1 SV=1
8	X6R7H2	4.1	34.7	631	0.019	0.052	X6R7H2_HUMAN PPARG related coactivator 1 OS=Homo sapiens OX=9606 GN=PPRC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15327 Tankyrase_bdg_C	3.2e-61	218.1	Tankyrase binding protein C terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437271

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355279	0.995	CCR4-NOT transcription complex subunit 7
2	9606.ENSP00000289382	0.988	CCR4-NOT transcription complex subunit 11
3	9606.ENSP00000399862	0.982	CCR4-NOT transcription complex subunit 10
4	9606.ENSP00000424896	0.981	CCR4-NOT transcription complex subunit 6-like
5	9606.ENSP00000229195	0.980	CCR4-NOT transcription complex subunit 2
6	9606.ENSP00000430493	0.973	CCR4-NOT transcription complex subunit 8
7	9606.ENSP00000377024	0.968	CCR4-NOT transcription complex subunit 6
8	9606.ENSP00000427695	0.967	Protein Tob1
9	9606.ENSP00000320949	0.965	CCR4-NOT transcription complex subunit 1
10	9606.ENSP00000311579	0.959	Tankyrase-1
11	9606.ENSP00000273064	0.956	CCR4-NOT transcription complex subunit 9
12	9606.ENSP00000351159	0.941	CCR4-NOT transcription complex subunit 3
13	9606.ENSP00000416255	0.928	Eukaryotic translation initiation factor 4 gamma 1
14	9606.ENSP00000313007	0.910	Polyadenylate-binding protein 1
15	9606.ENSP00000293831	0.904	Eukaryotic initiation factor 4A-I
16	9606.ENSP00000326381	0.902	Eukaryotic initiation factor 4A-II
17	9606.ENSP00000269349	0.900	Eukaryotic initiation factor 4A-III
18	9606.ENSP00000302768	0.900	Polyadenylate-binding protein-interacting protein 1
19	9606.ENSP00000388806	0.900	Eukaryotic translation initiation factor 4B
20	9606.ENSP00000425561	0.900	Eukaryotic translation initiation factor 4E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0019899	1.000	enzyme binding
GO:0071532	1.000	ankyrin repeat binding
GO:0045296	1.000	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0044238	0.983	primary metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0048522	0.979	positive regulation of cellular process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0051246	0.977	regulation of protein metabolic process
GO:0044237	0.973	cellular metabolic process
GO:0051173	0.966	positive regulation of nitrogen compound metabolic process
GO:0010604	0.966	positive regulation of macromolecule metabolic process
GO:0031325	0.966	positive regulation of cellular metabolic process
GO:0034641	0.957	cellular nitrogen compound metabolic process
GO:0044260	0.952	cellular macromolecule metabolic process
GO:0090304	0.952	nucleic acid metabolic process
GO:0050896	0.686	response to stimulus
GO:0051247	0.484	positive regulation of protein metabolic process
GO:0051716	0.459	cellular response to stimulus
GO:0006950	0.430	response to stress
GO:0019219	0.406	regulation of nucleobase-containing compound metabolic process
GO:0019220	0.404	regulation of phosphate metabolic process
GO:0031399	0.404	regulation of protein modification process
GO:0048519	0.355	negative regulation of biological process
GO:0010556	0.351	regulation of macromolecule biosynthetic process
GO:0031326	0.350	regulation of cellular biosynthetic process
GO:0010468	0.344	regulation of gene expression
GO:0001932	0.334	regulation of protein phosphorylation
GO:0051252	0.307	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.980	protein-containing complex
GO:0005829	0.977	cytosol
GO:0043229	0.965	intracellular organelle
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0005634	0.939	nucleus
GO:0043232	0.833	intracellular non-membrane-bounded organelle
GO:0000785	0.462	chromatin
GO:0000792	0.446	heterochromatin
GO:0030054	0.445	cell junction
GO:0005911	0.435	cell-cell junction
GO:0005912	0.418	adherens junction
GO:0030014	0.375	CCR4-NOT complex
GO:0031981	0.338	nuclear lumen
GO:0005654	0.312	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]