StarFunc result for job id Q9C0C4

User Input

>input (833 residues)
MAPHWAVWLLAARLWGLGIGAEVWWNLVPRKTVSSGELATVVRRFSQTGIQDFLTLTLTE
PTGLLYVGAREALFAFSMEALELQGAISWEAPVEKKTECIQKGKNNQTECFNFIRFLQPY
NASHLYVCGTYAFQPKCTYVNMLTFTLEHGEFEDGKGKCPYDPAKGHAGLLVDGELYSAT
LNNFLGTEPIILRNMGPHHSMKTEYLAFWLNEPHFVGSAYVPESVGSFTGDDDKVYFFFR
ERAVESDCYAEQVVARVARVCKGDMGGARTLQRKWTTFLKARLACSAPNWQLYFNQLQAM
HTLQDTSWHNTTFFGVFQAQWGDMYLSAICEYQLEEIQRVFEGPYKEYHEEAQKWDRYTD
PVPSPRPGSCINNWHRRHGYTSSLELPDNILNFVKKHPLMEEQVGPRWSRPLLVKKGTNF
THLVADRVTGLDGATYTVLFIGTGDGWLLKAVSLGPWVHLIEELQLFDQEPMRSLVLSQS
KKLLFAGSRSQLVQLPVADCMKYRSCADCVLARDPYCAWSVNTSRCVAVGGHSGSLLIQH
VMTSDTSGICNLRGSKKVRPTPKNITVVAGTDLVLPCHLSSNLAHARWTFGGRDLPAEQP
GSFLYDARLQALVVMAAQPRHAGAYHCFSEEQGARLAAEGYLVAVVAGPSVTLEARAPLE
NLGLVWLAVVALGAVCLVLLLLVLSLRRRLREELEKGAKATERTLVYPLELPKEPTSPPF
RPCPEPDEKLWDPVGYYYSDGSLKIVPGHARCQPGGGPPSPPPGIPGQPLPSPTRLHLGG
GRNSNANGYVRLQLGGEDRGGLGHPLPELADELRRKLQQRQPLPDSNPEESSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q64151	0.817	0.816	0.000	834	0.878	0.876	Q64151.pdb.gz	SEM4C_MOUSE Semaphorin-4C OS=Mus musculus OX=10090 GN=Sema4c PE=1 SV=1
2	AFDB:Q9C0C4	1.000	1.000	0.000	833	1.000	1.000	Q9C0C4.pdb.gz	SEM4C_HUMAN Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2
3	AFDB:Q9NTN9	0.736	0.732	4.872E-81	838	0.407	0.405	Q9NTN9.pdb.gz	SEM4G_HUMAN Semaphorin-4G OS=Homo sapiens OX=9606 GN=SEMA4G PE=1 SV=1
4	AFDB:O09126	0.714	0.691	2.166E-77	861	0.365	0.353	O09126.pdb.gz	SEM4D_MOUSE Semaphorin-4D OS=Mus musculus OX=10090 GN=Sema4d PE=1 SV=2
5	AFDB:Q62179	0.715	0.724	3.297E-77	823	0.360	0.365	Q62179.pdb.gz	SEM4B_MOUSE Semaphorin-4B OS=Mus musculus OX=10090 GN=Sema4b PE=1 SV=2
6	AFDB:Q92854	0.711	0.688	1.434E-76	862	0.359	0.347	Q92854.pdb.gz	SEM4D_HUMAN Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D PE=1 SV=1
7	AFDB:Q9Z123	0.698	0.746	1.652E-71	777	0.318	0.341	Q9Z123.pdb.gz	SEM4F_MOUSE Semaphorin-4F OS=Mus musculus OX=10090 GN=Sema4f PE=1 SV=2
8	AFDB:Q62178	0.678	0.740	1.153E-70	760	0.319	0.350	Q62178.pdb.gz	SEM4A_MOUSE Semaphorin-4A OS=Mus musculus OX=10090 GN=Sema4a PE=1 SV=2
9	AFDB:Q9H3S1	0.680	0.742	6.184E-70	761	0.322	0.352	Q9H3S1.pdb.gz	SEM4A_HUMAN Semaphorin-4A OS=Homo sapiens OX=9606 GN=SEMA4A PE=1 SV=2
10	AFDB:Q1LVE1	0.701	0.777	1.014E-66	749	0.291	0.323	Q1LVE1.pdb.gz
11	PDB:6qp7A	0.624	0.824	7.423E-54	620	0.229	0.308	6qp7A.pdb.gz	Diversity of oligomerization in Drosophila semaphorins suggests a mechanism of functional fine-tuning.
12	PDB:3nvqA	0.605	0.839	6.574E-42	588	0.178	0.252	3nvqA.pdb.gz
13	PDB:3nvnA	0.408	0.848	7.619E-22	383	0.090	0.196	3nvnA.pdb.gz	Structural Basis of Semaphorin-Plexin Recognition and Viral Mimicry from Sema7A and A39R Complexes with PlexinC1.
14	PDB:6vxkB	0.378	0.417	2.807E-15	747	0.121	0.135	6vxkB.pdb.gz
15	PDB:5y31B	0.275	0.414	1.098E-7	511	0.040	0.065	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
16	PDB:7mq8LR	0.096	0.102	3.872E-7	773	0.054	0.058	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7mq8SG	0.251	0.496	5.034E-7	389	0.065	0.139	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7mq8LN	0.151	0.181	6.210E-7	671	0.049	0.061	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:4a11B	0.233	0.474	9.452E-7	365	0.067	0.153	4a11B.pdb.gz
20	PDB:5jowA	0.159	0.228	1.516E-6	504	0.061	0.101	5jowA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q64151	0.0	1443	834	0.879	0.878	SEM4C_MOUSE Semaphorin-4C OS=Mus musculus OX=10090 GN=Sema4c PE=1 SV=1
2	Q9C0C4	0.0	1722	833	1.000	1.000	SEM4C_HUMAN Semaphorin-4C OS=Homo sapiens OX=9606 GN=SEMA4C PE=1 SV=2
3	Q9NTN9	6.34e-168	509	838	0.354	0.352	SEM4G_HUMAN Semaphorin-4G OS=Homo sapiens OX=9606 GN=SEMA4G PE=1 SV=1
4	Q9WUH7	8.16e-165	501	837	0.349	0.348	SEM4G_MOUSE Semaphorin-4G OS=Mus musculus OX=10090 GN=Sema4g PE=1 SV=1
5	O09126	3.65e-164	500	861	0.336	0.325	SEM4D_MOUSE Semaphorin-4D OS=Mus musculus OX=10090 GN=Sema4d PE=1 SV=2
6	Q92854	7.84e-163	497	862	0.331	0.320	SEM4D_HUMAN Semaphorin-4D OS=Homo sapiens OX=9606 GN=SEMA4D PE=1 SV=1
7	Q62179	3.09e-151	466	823	0.337	0.341	SEM4B_MOUSE Semaphorin-4B OS=Mus musculus OX=10090 GN=Sema4b PE=1 SV=2
8	O95754	1.01e-128	405	770	0.317	0.343	SEM4F_HUMAN Semaphorin-4F OS=Homo sapiens OX=9606 GN=SEMA4F PE=2 SV=2
9	Q9H3S1	5.61e-128	403	761	0.297	0.325	SEM4A_HUMAN Semaphorin-4A OS=Homo sapiens OX=9606 GN=SEMA4A PE=1 SV=2
10	Q9Z143	7.53e-128	403	776	0.285	0.305	SEM4F_RAT Semaphorin-4F OS=Rattus norvegicus OX=10116 GN=Sema4f PE=1 SV=1
11	Q62178	1.87e-127	402	760	0.293	0.321	SEM4A_MOUSE Semaphorin-4A OS=Mus musculus OX=10090 GN=Sema4a PE=1 SV=2
12	Q9Z123	3.01e-126	399	777	0.283	0.304	SEM4F_MOUSE Semaphorin-4F OS=Mus musculus OX=10090 GN=Sema4f PE=1 SV=2
13	O08665	1.93e-114	368	772	0.277	0.299	SEM3A_MOUSE Semaphorin-3A OS=Mus musculus OX=10090 GN=Sema3a PE=1 SV=2
14	Q14563	2.03e-114	368	771	0.282	0.305	SEM3A_HUMAN Semaphorin-3A OS=Homo sapiens OX=9606 GN=SEMA3A PE=1 SV=1
15	Q63548	1.28e-113	365	772	0.276	0.298	SEM3A_RAT Semaphorin-3A OS=Rattus norvegicus OX=10116 GN=Sema3a PE=2 SV=1
16	Q90607	8.12e-111	358	772	0.279	0.301	SEM3A_CHICK Semaphorin-3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=1 SV=1
17	Q90663	1.98e-110	357	761	0.264	0.289	SEM3D_CHICK Semaphorin-3D OS=Gallus gallus OX=9031 GN=SEMA3D PE=2 SV=1
18	F1NVZ5	2.28e-110	358	808	0.279	0.287	F1NVZ5_CHICK Semaphorin 3A OS=Gallus gallus OX=9031 GN=SEMA3A PE=3 SV=2
19	Q9W686	7.25e-110	356	778	0.271	0.290	SE3AB_DANRE Semaphorin-3ab OS=Danio rerio OX=7955 GN=sema3ab PE=2 SV=1
20	Q9W7J1	1.63e-107	352	860	0.261	0.252	SE3AA_DANRE Semaphorin-3aa OS=Danio rerio OX=7955 GN=sema3aa PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	10	17.6	Immunoglobulin I-set domain
2	PF13895 Ig_2	0.36	22.5	Immunoglobulin domain
3	PF13927 Ig_3	2.9	19.8	Immunoglobulin domain
4	PF01437 PSI	0.00026	32.8	Plexin repeat
5	PF01403 Sema	2.2e-55	198.9	Sema domain
6	PF19428 Sema4F_C	3.3	18.6	Semaphorin 4F C-terminal
7	PF07686 V-set	2.6e+02	13.2	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306844

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.823	Disks large homolog 4
2	9606.ENSP00000409171	0.821	Plexin-B2
3	9606.ENSP00000351338	0.808	Plexin-B1
4	9606.ENSP00000442736	0.808	Plexin-B3
5	9606.ENSP00000265371	0.777	Neuropilin-1
6	9606.ENSP00000353582	0.753	Neuropilin-2
7	9606.ENSP00000376753	0.689	PDZ domain-containing protein GIPC1
8	9606.ENSP00000173229	0.672	Netrin-1
9	9606.ENSP00000264249	0.645	Carbohydrate sulfotransferase 10
10	9606.ENSP00000319254	0.619	PDZ domain-containing protein GIPC3
11	9606.ENSP00000478570	0.612	Vascular endothelial growth factor A
12	9606.ENSP00000275815	0.605	Ephrin type-A receptor 1
13	9606.ENSP00000379980	0.595	B-cell differentiation antigen CD72
14	9606.ENSP00000379880	0.584	Leucine-rich repeat-containing protein 3B
15	9606.ENSP00000332164	0.570	Slit homolog 3 protein
16	9606.ENSP00000337838	0.562	Reticulon-4
17	9606.ENSP00000247271	0.556	Oligodendrocyte-myelin glycoprotein
18	9606.ENSP00000362340	0.556	Neurochondrin
19	9606.ENSP00000384018	0.547	Nuclear receptor corepressor 2
20	9606.ENSP00000377140	0.542	Cyclic nucleotide-gated cation channel alpha-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.982	signaling receptor binding
GO:0038191	0.357	neuropilin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0048856	0.981	anatomical structure development
GO:0050896	0.976	response to stimulus
GO:0032501	0.975	multicellular organismal process
GO:0007275	0.948	multicellular organism development
GO:0048522	0.946	positive regulation of cellular process
GO:0007399	0.931	nervous system development
GO:0030154	0.925	cell differentiation
GO:0009653	0.918	anatomical structure morphogenesis
GO:0007165	0.888	signal transduction
GO:0048583	0.830	regulation of response to stimulus
GO:0048468	0.799	cell development
GO:0007166	0.746	cell surface receptor signaling pathway
GO:0009966	0.690	regulation of signal transduction
GO:1902531	0.667	regulation of intracellular signal transduction
GO:0043408	0.564	regulation of MAPK cascade
GO:0048519	0.562	negative regulation of biological process
GO:0048523	0.522	negative regulation of cellular process
GO:0071840	0.518	cellular component organization or biogenesis
GO:0009967	0.515	positive regulation of signal transduction
GO:1902533	0.477	positive regulation of intracellular signal transduction
GO:0016043	0.464	cellular component organization
GO:0050793	0.457	regulation of developmental process
GO:0051239	0.440	regulation of multicellular organismal process
GO:0061061	0.417	muscle structure development
GO:0042692	0.386	muscle cell differentiation
GO:0051128	0.385	regulation of cellular component organization
GO:0019222	0.307	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.995	membrane
GO:0071944	0.993	cell periphery
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005576	0.992	extracellular region
GO:0005737	0.991	cytoplasm
GO:0012505	0.986	endomembrane system
GO:0005886	0.979	plasma membrane
GO:0005615	0.934	extracellular space
GO:0031982	0.923	vesicle
GO:0030054	0.654	cell junction
GO:1903561	0.547	extracellular vesicle
GO:0070062	0.544	extracellular exosome
GO:0031410	0.449	cytoplasmic vesicle
GO:0045202	0.356	synapse
GO:0070013	0.323	intracellular organelle lumen
GO:0098794	0.317	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]