StarFunc result for job id Q9C0C7

User Input

>input (1298 residues)
MKVVPEKNAVRILWGRERGARAMGAQRLLQELVEDKTRWMKWEGKRVELPDSPRSTFLLA
FSPDRTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEV
RIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEM
ERVRLVRFDPLGHYLLTAIVNPSNQQGDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLL
HNFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTERPRTSAYIRLRQRVSYPTAE
CCQHLGILCLCSRCSGTRVPSLLPHQDSVPPASARATTPSFSFVQTEPFHPPEQASSTQQ
DQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHREIAPGLTGSEWT
RTVLSLNSRSEAESMPPPRTSASSVSLLSVLRQQEGGSQASVYTSATEGRGFPASGLATE
SDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGEAPQTQQAQEMLNNNIES
ERPGPSHQPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSW
QVPSSFESVPSSGSQLPPLERTEGQTPSSSRLELSSSASPQEERTVGVAFNQETGHWERI
YTQSSRSGTVSQEALHQDMPEESSEEDSLRRRLLESSLISLSRYDGAGSREHPIYPDPAR
LSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVEGTDLEFEDFE
DNGDRSRHRAPRNARMSAPSLGRFVPRRFLLPEYLPYAGIFHERGQPGLATHSSVNRVLA
GAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNASVNVLVQNCKIYNDASCDISAD
GQLLAAFIPSSQRGFPDEGILAVYSLAPHNLGEMLYTKRFGPNAISVSLSPMGRYVMVGL
ASRRILLHPSTEHMVAQVFRLQQAHGGETSMRRVFNVLYPMPADQRRHVSINSARWLPEP
GLGLAYGTNKGDLVICRPEALNSGVEYYWDQLNETVFTVHSNSRSSERPGTSRATWRTDR
DMGLMNAIGLQPRNPATSVTSQGTQTLALQLQNAETQTEREVPEPGTAASGPGEGEGSEY
GASGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQTGTEPGA
AHTSSPQPSTSRGLLPEAGQLAERGLSPRTASWDQPGTPGREPTQPTLPSSSPVPIPVSL
PSAEGPTLHCELTNNNHLLDGGSSRGDAAGPRGEPRNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K5B6	0.374	0.397	0.000	1209	0.891	0.956	A0A0G2K5B6.pdb.gz	A0A0G2K5B6_RAT Autophagy and beclin 1 regulator 1 OS=Rattus norvegicus OX=10116 GN=Ambra1 PE=4 SV=2
2	AFDB:A2AH22	0.425	0.425	0.000	1300	0.958	0.956	A2AH22.pdb.gz	AMRA1_MOUSE Activating molecule in BECN1-regulated autophagy protein 1 OS=Mus musculus OX=10090 GN=Ambra1 PE=1 SV=1
3	AFDB:E7FAG6	0.367	0.364	0.000	1315	0.579	0.571	E7FAG6.pdb.gz	AMR1A_DANRE Activating molecule in BECN1-regulated autophagy protein 1A OS=Danio rerio OX=7955 GN=ambra1a PE=2 SV=2
4	AFDB:X1WHY6	0.395	0.380	0.000	1360	0.599	0.572	X1WHY6.pdb.gz	AMR1B_DANRE Activating molecule in BECN1-regulated autophagy protein 1B OS=Danio rerio OX=7955 GN=ambra1b PE=2 SV=1
5	AFDB:A0A1P8AW69	0.113	0.141	1.260E-12	1019	0.109	0.138	A0A1P8AW69.pdb.gz	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
6	PDB:2h9lA	0.103	0.404	1.029E-10	321	0.032	0.131	2h9lA.pdb.gz
7	PDB:5yzgs	0.106	0.356	1.592E-10	374	0.025	0.086	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
8	PDB:7ktrB	0.105	0.249	2.208E-10	534	0.028	0.067	7ktrB.pdb.gz	Structure of the human SAGA coactivator complex.
9	PDB:7qdrC	0.100	0.409	1.134E-9	305	0.028	0.118	7qdrC.pdb.gz
10	PDB:5nnzA	0.104	0.341	1.264E-9	335	0.018	0.072	5nnzA.pdb.gz
11	PDB:7mq8LU	0.117	0.329	1.335E-9	445	0.017	0.049	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:3dm0A	0.111	0.209	3.374E-9	675	0.027	0.052	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
13	PDB:5mzhB	0.119	0.331	3.374E-9	415	0.027	0.084	5mzhB.pdb.gz
14	PDB:4a11B	0.132	0.442	4.197E-9	365	0.027	0.096	4a11B.pdb.gz
15	PDB:5o9zL	0.110	0.300	4.432E-9	459	0.021	0.059	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
16	AFDB:M9PB01	0.102	0.060	3.724E-7	2397	0.144	0.078	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
17	AFDB:O60336	0.102	0.088	1.236E-6	1514	0.111	0.095	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
18	AFDB:Q960J6	0.115	0.125	1.912E-6	1183	0.117	0.128	Q960J6.pdb.gz	Q960J6_DROME LD47622p OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=2 SV=1
19	AFDB:Q90X22	0.042	0.043	9.992E-3	1276	0.124	0.126	Q90X22.pdb.gz
20	AFDB:Q9Z0Y7	0.064	0.068	9.992E-3	1216	0.144	0.154	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K5B6	0.0	1717	1209	0.700	0.751	A0A0G2K5B6_RAT Autophagy and beclin 1 regulator 1 OS=Rattus norvegicus OX=10116 GN=Ambra1 PE=4 SV=2
2	A0A8I6AF66	0.0	1665	1180	0.677	0.745	A0A8I6AF66_RAT Autophagy and beclin 1 regulator 1 OS=Rattus norvegicus OX=10116 GN=Ambra1 PE=4 SV=1
3	A0A8I6AGV8	0.0	2082	1240	0.856	0.896	A0A8I6AGV8_RAT Autophagy and beclin 1 regulator 1 OS=Rattus norvegicus OX=10116 GN=Ambra1 PE=4 SV=1
4	A2AH22	0.0	2360	1300	0.958	0.957	AMRA1_MOUSE Activating molecule in BECN1-regulated autophagy protein 1 OS=Mus musculus OX=10090 GN=Ambra1 PE=1 SV=1
5	E7FAG6	0.0	1298	1315	0.576	0.569	AMR1A_DANRE Activating molecule in BECN1-regulated autophagy protein 1A OS=Danio rerio OX=7955 GN=ambra1a PE=2 SV=2
6	F1LNQ2	0.0	2399	1300	0.961	0.959	F1LNQ2_RAT Autophagy and beclin 1 regulator 1 OS=Rattus norvegicus OX=10116 GN=Ambra1 PE=4 SV=4
7	Q9C0C7	0.0	2651	1298	1.000	1.000	AMRA1_HUMAN Activating molecule in BECN1-regulated autophagy protein 1 OS=Homo sapiens OX=9606 GN=AMBRA1 PE=1 SV=2
8	X1WHY6	0.0	1398	1360	0.606	0.579	AMR1B_DANRE Activating molecule in BECN1-regulated autophagy protein 1B OS=Danio rerio OX=7955 GN=ambra1b PE=2 SV=1
9	F4K7D1	4.05e-22	105	752	0.059	0.102	F4K7D1_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=RTP5 PE=1 SV=1
10	Q54KL5	9.26e-10	64.3	335	0.032	0.122	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
11	Q7ZTX2	1.21e-09	63.9	334	0.032	0.123	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
12	F4HTH8	1.32e-09	65.5	1181	0.039	0.042	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
13	Q4V8C4	1.56e-09	63.5	328	0.031	0.122	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
14	P61964	2.60e-09	62.8	334	0.032	0.123	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
15	P61965	2.60e-09	62.8	334	0.032	0.123	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
16	Q498M4	2.60e-09	62.8	334	0.032	0.123	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
17	Q7ZUV2	4.17e-09	63.5	694	0.035	0.066	KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio OX=7955 GN=katnb1 PE=2 SV=1
18	Q9V3J8	6.13e-09	62.0	361	0.036	0.130	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
19	Q17963	2.72e-08	60.1	376	0.029	0.101	WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.1 PE=1 SV=1
20	Q9M2Z2	4.44e-08	58.9	317	0.032	0.132	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02551 Acyl_CoA_thio	5.4e+02	11.8	Acyl-CoA thioesterase
2	PF12894 ANAPC4_WD40	0.015	26.9	Anaphase-promoting complex subunit 4 WD40 domain
3	PF08662 eIF2A	82	14.5	Eukaryotic translation initiation factor eIF2A
4	PF00400 WD40	0.055	25.5	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000006158

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000046569	0.996	Beclin 1, autophagy related
2	9598.ENSPTRP00000010813	0.983	ATG14 autophagy related 14 homolog
3	9598.ENSPTRP00000049400	0.981	Phosphoinositide-3-kinase, class 3
4	9598.ENSPTRP00000026520	0.977	Phosphoinositide-3-kinase, regulatory subunit 4
5	9598.ENSPTRP00000042372	0.972	Uncharacterized protein
6	9598.ENSPTRP00000006096	0.963	Belongs to the TNF receptor-associated factor family.
7	9598.ENSPTRP00000032068	0.953	E3 ubiquitin-protein ligase parkin
8	9598.ENSPTRP00000048051	0.906	Damage-specific DNA binding protein 1, 127kDa
9	9598.ENSPTRP00000006164	0.881	Autophagy factor required for autophagosome formation and mitophagy. Target of the TOR kinase signaling pathway that regulates autophagy through the control of the phosphorylation status of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex. Through its regulation of ULK1 activity, plays a role in the regulation of the kinase activity of mTORC1 and cell proliferation.
10	9598.ENSPTRP00000034671	0.869	RB1-inducible coiled-coil 1
11	9598.ENSPTRP00000008480	0.830	Chromosome 12 open reading frame 44
12	9598.ENSPTRP00000055273	0.824	Nuclear receptor binding factor 2
13	9598.ENSPTRP00000010296	0.814	Cullin 4A
14	9598.ENSPTRP00000007026	0.800	UV radiation resistance associated protein
15	9598.ENSPTRP00000007307	0.785	Cullin 5
16	9598.ENSPTRP00000052251	0.705	RNA binding protein, autoantigenic (HnRNP-associated with lethal yellow homolog )
17	9598.ENSPTRP00000048113	0.703	Ubiquitin-like protein ATG12
18	9598.ENSPTRP00000048213	0.697	Non-specific serine/threonine protein kinase
19	9598.ENSPTRP00000057559	0.687	RB binding protein 5, histone lysine methyltransferase complex subunit
20	9598.ENSPTRP00000044421	0.685	Ash2 (Absent, small, or homeotic)-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0006950	0.989	response to stress
GO:0010506	0.986	regulation of autophagy
GO:0031331	0.982	positive regulation of cellular catabolic process
GO:0009605	0.978	response to external stimulus
GO:0010941	0.969	regulation of cell death
GO:0009267	0.965	cellular response to starvation
GO:0010660	0.955	regulation of muscle cell apoptotic process
GO:0010508	0.908	positive regulation of autophagy
GO:0010662	0.891	regulation of striated muscle cell apoptotic process
GO:0010656	0.891	negative regulation of muscle cell apoptotic process
GO:0010664	0.862	negative regulation of striated muscle cell apoptotic process
GO:0010665	0.846	regulation of cardiac muscle cell apoptotic process
GO:0044237	0.843	cellular metabolic process
GO:0010667	0.686	negative regulation of cardiac muscle cell apoptotic process
GO:0061919	0.520	process utilizing autophagic mechanism
GO:0044238	0.516	primary metabolic process
GO:0006914	0.482	autophagy
GO:0071840	0.444	cellular component organization or biogenesis
GO:0071704	0.416	organic substance metabolic process
GO:0016043	0.411	cellular component organization
GO:0080090	0.411	regulation of primary metabolic process
GO:0060255	0.393	regulation of macromolecule metabolic process
GO:0032502	0.392	developmental process
GO:0032501	0.376	multicellular organismal process
GO:0006996	0.362	organelle organization
GO:0051171	0.336	regulation of nitrogen compound metabolic process
GO:0006807	0.310	nitrogen compound metabolic process
GO:0043170	0.305	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.999	nucleus
GO:0005856	0.995	cytoskeleton
GO:0032991	0.913	protein-containing complex
GO:0012505	0.912	endomembrane system
GO:0031982	0.655	vesicle
GO:0031410	0.632	cytoplasmic vesicle
GO:0120025	0.566	plasma membrane bounded cell projection
GO:1990234	0.523	transferase complex
GO:0005929	0.430	cilium
GO:0099568	0.343	cytoplasmic region
GO:0005739	0.337	mitochondrion
GO:0097014	0.329	ciliary plasm
GO:0005930	0.305	axoneme

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]