StarFunc result for job id Q9C0C9

User Input

>input (1292 residues)
MADPAAPTPAAPAPAQAPAPAPEAVPAPAAAPVPAPAPASDSASGPSSDSGPEAGSQRLL
FSHDLVSGRYRGSVHFGLVRLIHGEDSDSEGEEEGRGSSGCSEAGGAGHEEGRASPLRRG
YVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKLIGT
NCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDGAKL
YDVCPHVSDSGLFFDDSYGFYPGQVLIGPAKIFSSVQWLSGVKPVLSTKSKFRVVVEEVQ
VVELKVTWITKSFCPGGTDSVSPPPSVITQENLGRVKRLGCFDHAQRQLGERCLYVFPAK
VEPAKIAWECPEKNCAQGEGSMAKKVKRLLKKQVVRIMSCSPDTQCSRDHSMEDPDKKGE
SKTKSEAESASPEETPDGSASPVEMQDEGAEEPHEAGEQLPPFLLKEGRDDRLHSAEQDA
DDEAADDTDDTSSVTSSASSTTSSQSGSGTSRKKSIPLSIKNLKRKHKRKKNKITRDFKP
GDRVAVEVVTTMTSADVMWQDGSVECNIRSNDLFPVHHLDNNEFCPGDFVVDKRVQSCPD
PAVYGVVQSGDHIGRTCMVKWFKLRPSGDDVELIGEEEDVSVYDIADHPDFRFRTTDIVI
RIGNTEDGAPHKEDEPSVGQVARVDVSSKVEVVWADNSKTIILPQHLYNIESEIEESDYD
SVEGSTSGASSDEWEDDSDSWETDNGLVEDEHPKIEEPPIPPLEQPVAPEDKGVVISEEA
ATAAVQGAVAMAAPMAGLMEKAGKDGPPKSFRELKEAIKILESLKNMTVEQLLTGSPTSP
TVEPEKPTREKKFLDDIKKLQENLKKTLDNVAIVEEEKMEAVPDVERKEDKPEGQSPVKA
EWPSETPVLCQQCGGKPGVTFTSAKGEVFSVLEFAPSNHSFKKIEFQPPEAKKFFSTVRK
EMALLATSLPEGIMVKTFEDRMDLFSALIKGPTRTPYEDGLYLFDIQLPNIYPAVPPHFC
YLSQCSGRLNPNLYDNGKVCVSLLGTWIGKGTERWTSKSSLLQVLISIQGLILVNEPYYN
EAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIRQHFSTGGWRLVN
RIESWLETHALLEKAQALPNGVPKASSSPEPPAVAELSDSGQQEPEDGGPAPGEASQGSD
SEGGAQGLASASRDHTDQTSETAPDASVPPSVKPKKRRKSYRSFLPEKSGYPDIGFPLFP
LSKGFIKSIRGVLTQFRAALLEAGMPECTEDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0C9	1.000	1.000	0.000	1292	1.000	1.000	Q9C0C9.pdb.gz	UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3
2	PDB:7un3A	0.472	0.908	6.303E-89	649	0.501	0.997	7un3A.pdb.gz
3	PDB:5a4pA	0.129	0.651	1.093E-11	227	0.048	0.273	5a4pA.pdb.gz
4	PDB:4ccgA	0.103	0.749	9.063E-9	157	0.034	0.280	4ccgA.pdb.gz	Structure of the Human Fancl Ring-Ube2T Complex Reveals Determinants of Cognate E3-E2 Selection.
5	PDB:6cyrA	0.106	0.765	2.113E-8	153	0.035	0.294	6cyrA.pdb.gz
6	PDB:2cyxA	0.108	0.738	1.277E-7	169	0.033	0.249	2cyxA.pdb.gz
7	PDB:6op8A	0.102	0.672	1.420E-7	167	0.033	0.257	6op8A.pdb.gz
8	PDB:4ii2C	0.098	0.754	1.578E-7	149	0.029	0.248	4ii2C.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
9	PDB:7jzvA	0.096	0.419	1.850E-7	253	0.026	0.134	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
10	PDB:2uczA	0.110	0.766	2.825E-7	164	0.033	0.262	2uczA.pdb.gz
11	PDB:6zhtB	0.099	0.724	2.825E-7	153	0.030	0.255	6zhtB.pdb.gz
12	AFDB:Q9VZT8	0.041	0.039	4.952E-3	1443	0.130	0.116	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
13	AFDB:P39059	0.033	0.032	3.156E-2	1388	0.101	0.094	P39059.pdb.gz	COFA1_HUMAN Collagen alpha-1(XV) chain OS=Homo sapiens OX=9606 GN=COL15A1 PE=1 SV=2
14	AFDB:D3ZRA6	0.054	0.042	3.327E-2	1683	0.147	0.113	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
15	AFDB:F8W451	0.041	0.046	5.080E-2	1133	0.111	0.127	F8W451.pdb.gz	F8W451_DANRE MLLT10 histone lysine methyltransferase DOT1L cofactor OS=Danio rerio OX=7955 GN=mllt10 PE=4 SV=1
16	AFDB:Q9JIR0	0.043	0.035	5.080E-2	1847	0.128	0.089	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
17	AFDB:Q6DRG7	0.043	0.050	6.278E-2	1049	0.078	0.096	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
18	AFDB:Q59IW5	0.041	0.045	8.180E-2	1115	0.115	0.134	Q59IW5.pdb.gz	Q59IW5_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
19	AFDB:O95153	0.047	0.037	1.011E-1	1857	0.094	0.065	O95153.pdb.gz	RIMB1_HUMAN Peripheral-type benzodiazepine receptor-associated protein 1 OS=Homo sapiens OX=9606 GN=TSPOAP1 PE=1 SV=2
20	AFDB:Q8IL19	0.040	0.054	1.066E-1	881	0.060	0.087	Q8IL19.pdb.gz	Q8IL19_PLAF7 Protein serine/threonine kinase-1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1445400 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZPJ3	0.0	2280	1288	0.919	0.922	UBE2O_MOUSE (E3-independent) E2 ubiquitin-conjugating enzyme UBE2O OS=Mus musculus OX=10090 GN=Ube2o PE=1 SV=3
2	Q9C0C9	0.0	2656	1292	1.000	1.000	UBE2O_HUMAN (E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3
3	Q8VY10	3.76e-39	160	907	0.068	0.097	UBC24_ARATH Probable ubiquitin-conjugating enzyme E2 24 OS=Arabidopsis thaliana OX=3702 GN=UBC24 PE=1 SV=1
4	A0A0B4KG50	5.96e-35	149	4976	0.067	0.017	A0A0B4KG50_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform B OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
5	A0A0B4KGR9	7.16e-35	148	4875	0.067	0.018	A0A0B4KGR9_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform D OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
6	Q9VH01	7.16e-35	148	4876	0.067	0.018	Q9VH01_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform A OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=3
7	A0A0B4KFQ0	7.28e-35	148	4865	0.067	0.018	A0A0B4KFQ0_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform E OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
8	A0A0B4KH36	7.46e-35	148	4852	0.067	0.018	A0A0B4KH36_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform C OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
9	O88738	1.59e-33	144	4882	0.057	0.015	BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus OX=10090 GN=Birc6 PE=1 SV=2
10	Q9NR09	3.67e-33	143	4857	0.056	0.015	BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=3
11	Q9H832	2.65e-21	99.4	354	0.046	0.167	UBE2Z_HUMAN Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z PE=1 SV=2
12	Q3UE37	3.14e-21	99.4	356	0.046	0.166	UBE2Z_MOUSE Ubiquitin-conjugating enzyme E2 Z OS=Mus musculus OX=10090 GN=Ube2z PE=1 SV=2
13	P06104	4.85e-13	70.9	172	0.029	0.215	UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD6 PE=1 SV=1
14	Q9NPD8	2.94e-11	66.2	197	0.036	0.239	UBE2T_HUMAN Ubiquitin-conjugating enzyme E2 T OS=Homo sapiens OX=9606 GN=UBE2T PE=1 SV=1
15	P52490	4.34e-11	64.7	153	0.031	0.261	UBC13_YEAST Ubiquitin-conjugating enzyme E2 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC13 PE=1 SV=1
16	Q02159	4.66e-11	65.1	165	0.029	0.224	UBC7_YEAST Ubiquitin-conjugating enzyme E2 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC7 PE=1 SV=1
17	Q54F00	9.83e-11	66.6	292	0.029	0.130	Q54F00_DICDI UBC core domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291199 PE=3 SV=1
18	Q94A97	1.54e-10	63.2	153	0.027	0.229	UBC35_ARATH Ubiquitin-conjugating enzyme E2 35 OS=Arabidopsis thaliana OX=3702 GN=UBC35 PE=1 SV=1
19	P23566	1.55e-10	63.2	151	0.031	0.265	UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp6 PE=1 SV=3
20	O00102	5.49e-10	62.0	166	0.029	0.229	UBC7_SCHPO Ubiquitin-conjugating enzyme E2-18 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubc7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12745 HGTP_anticodon2	1.7e+02	13.1	Anticodon binding domain of tRNAs
2	PF00179 UQ_con	1.4e-20	84.8	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323687

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347836	0.963	Ubiquitin-conjugating enzyme E2 H
2	9606.ENSP00000397453	0.959	Ubiquitin-conjugating enzyme E2 W
3	9606.ENSP00000340305	0.958	Ubiquitin-conjugating enzyme E2 variant 1
4	9606.ENSP00000313454	0.951	Ubiquitin-like modifier-activating enzyme 6
5	9606.ENSP00000383719	0.951	Ubiquitin-conjugating enzyme E2 J2
6	9606.ENSP00000360116	0.949	Ubiquitin-conjugating enzyme E2 U
7	9606.ENSP00000292211	0.948	Ubiquitin-conjugating enzyme E2 Q1
8	9606.ENSP00000428209	0.946	Ubiquitin-conjugating enzyme E2 variant 2
9	9606.ENSP00000451261	0.946	Ubiquitin-conjugating enzyme E2 J1
10	9606.ENSP00000338413	0.943	Ubiquitin-like modifier-activating enzyme 1
11	9606.ENSP00000287156	0.940	Ubiquitin/ISG15-conjugating enzyme E2 L6
12	9606.ENSP00000363019	0.939	Ubiquitin-conjugating enzyme E2 D1
13	9606.ENSP00000267938	0.936	Ubiquitin-conjugating enzyme E2 Q2
14	9606.ENSP00000386788	0.936	Ubiquitin-conjugating enzyme E2 E3
15	9606.ENSP00000478474	0.936	NEDD8-conjugating enzyme UBE2F
16	9606.ENSP00000349722	0.933	Ubiquitin conjugating enzyme E2 D3
17	9606.ENSP00000303709	0.932	Ubiquitin-conjugating enzyme E2 E1
18	9606.ENSP00000253023	0.931	NEDD8-conjugating enzyme Ubc12
19	9606.ENSP00000333266	0.930	Ubiquitin-like modifier-activating enzyme 7
20	9606.ENSP00000379931	0.927	Ubiquitin-conjugating enzyme E2 E2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061631	0.997	ubiquitin conjugating enzyme activity
GO:1901363	0.976	heterocyclic compound binding
GO:0097159	0.976	organic cyclic compound binding
GO:0003676	0.959	nucleic acid binding
GO:0061630	0.915	ubiquitin protein ligase activity
GO:0003723	0.906	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0000209	0.986	protein polyubiquitination
GO:0009966	0.978	regulation of signal transduction
GO:0051179	0.964	localization
GO:0048518	0.947	positive regulation of biological process
GO:0048522	0.942	positive regulation of cellular process
GO:0070534	0.934	protein K63-linked ubiquitination
GO:0090287	0.923	regulation of cellular response to growth factor stimulus
GO:0090092	0.923	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0016482	0.907	cytosolic transport
GO:0048584	0.906	positive regulation of response to stimulus
GO:0016197	0.905	endosomal transport
GO:0009967	0.889	positive regulation of signal transduction
GO:0006513	0.887	protein monoubiquitination
GO:0030510	0.850	regulation of BMP signaling pathway
GO:0042147	0.791	retrograde transport, endosome to Golgi
GO:0090100	0.783	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030513	0.720	positive regulation of BMP signaling pathway
GO:0044237	0.395	cellular metabolic process
GO:0050896	0.362	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0016604	0.994	nuclear body
GO:0005829	0.776	cytosol
GO:0012505	0.301	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.2.23	0.997	E2 ubiquitin-conjugating enzyme.

[back to server]