StarFunc result for job id Q9C0D0

User Input

>input (580 residues)
MDYPKMDYFLDVESAHRLLDVESAQRFFYSQGAQARRATLLLPPTLMAASSEDDIDRRPI
RRVRSKSDTPYLAEARISFNLGAAEEVERLAAMRSDSLVPGTHTPPIRRRSKFANLGRIF
KPWKWRKKKSEKFKHTSAALERKISMRQSREELIKRGVLKEIYDKDGELSISNEEDSLEN
GQSLSSSQLSLPALSEMEPVPMPRDPCSYEVLQPSDIMDGPDPGAPVKLPCLPVKLSPPL
PPKKVMICMPVGGPDLSLVSYTAQKSGQQGVAQHHHTVLPSQIQHQLQYGSHGQHLPSTT
GSLPMHPSGCRMIDELNKTLAMTMQRLESSEQRVPCSTSYHSSGLHSGDGVTKAGPMGLP
EIRQVPTVVIECDDNKENVPHESDYEDSSCLYTREEEEEEEDEDDDSSLYTSSLAMKVCR
KDSLAIKLSNRPSKRELEEKNILPRQTDEERLELRQQIGTKLTRRLSQRPTAEELEQRNI
LKPRNEQEEQEEKREIKRRLTRKLSQRPTVEELRERKILIRFSDYVEVADAQDYDRRADK
PWTRLTAADKAAIRKELNEFKSTEMEVHELSRHLTRFHRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62024	0.479	0.479	5.351E-79	580	0.971	0.971	P62024.pdb.gz	PHAR1_RAT Phosphatase and actin regulator 1 OS=Rattus norvegicus OX=10116 GN=Phactr1 PE=1 SV=1
2	AFDB:Q96KR7	0.293	0.302	1.851E-28	559	0.410	0.426	Q96KR7.pdb.gz	PHAR3_HUMAN Phosphatase and actin regulator 3 OS=Homo sapiens OX=9606 GN=PHACTR3 PE=1 SV=1
3	AFDB:O75167	0.311	0.289	2.385E-25	634	0.402	0.368	O75167.pdb.gz	PHAR2_HUMAN Phosphatase and actin regulator 2 OS=Homo sapiens OX=9606 GN=PHACTR2 PE=1 SV=2
4	PDB:6zejI	0.083	0.133	5.293E-6	351	0.095	0.157	6zejI.pdb.gz	Molecular basis for substrate specificity of the Phactr1/PP1 phosphatase holoenzyme.
5	AFDB:P33304	0.082	0.078	5.394E-5	620	0.167	0.156	P33304.pdb.gz	AFR1_YEAST Protein AFR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AFR1 PE=1 SV=1
6	AFDB:Q13111	0.073	0.049	5.737E-2	956	0.133	0.081	Q13111.pdb.gz	CAF1A_HUMAN Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A PE=1 SV=3
7	AFDB:Q9D824	0.062	0.062	1.020E-1	581	0.116	0.115	Q9D824.pdb.gz	FIP1_MOUSE Pre-mRNA 3'-end-processing factor FIP1 OS=Mus musculus OX=10090 GN=Fip1l1 PE=1 SV=1
8	AFDB:Q9W3D1	0.068	0.041	1.236E-1	1183	0.131	0.064	Q9W3D1.pdb.gz	Q9W3D1_DROME Chromatin assembly factor 1, p180 subunit OS=Drosophila melanogaster OX=7227 GN=Caf1-180 PE=1 SV=1
9	AFDB:P17544	0.074	0.085	4.732E-1	483	0.148	0.178	P17544.pdb.gz	ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=3
10	AFDB:P43680	0.073	0.102	5.377E-1	377	0.117	0.180	P43680.pdb.gz	SOX18_MOUSE Transcription factor SOX-18 OS=Mus musculus OX=10090 GN=Sox18 PE=1 SV=3
11	AFDB:Q5DU05	0.051	0.032	7.403E-1	1446	0.143	0.057	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
12	PDB:6wucK	0.056	0.101	2.963	235	0.036	0.089	6wucK.pdb.gz
13	PDB:6wucH	0.055	0.128	5.988	179	0.050	0.162	6wucH.pdb.gz
14	PDB:6bk8O	0.043	0.093	6.804	229	0.036	0.092	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
15	PDB:3jb9W	0.060	0.074	8.243	426	0.055	0.075	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:7r72w	0.043	0.094	8.787	189	0.036	0.111	7r72w.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
17	PDB:5xjt2	0.042	0.092	9.367	217	0.028	0.074	5xjt2.pdb.gz	Structures of 7S mutant complexes
18	PDB:6zh3A	0.076	0.194	9.986	170	0.041	0.141	6zh3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62024	0.0	1159	580	0.971	0.971	PHAR1_RAT Phosphatase and actin regulator 1 OS=Rattus norvegicus OX=10116 GN=Phactr1 PE=1 SV=1
2	Q2M3X8	0.0	1157	580	0.969	0.969	PHAR1_MOUSE Phosphatase and actin regulator 1 OS=Mus musculus OX=10090 GN=Phactr1 PE=1 SV=1
3	Q9C0D0	0.0	1189	580	1.000	1.000	PHAR1_HUMAN Phosphatase and actin regulator 1 OS=Homo sapiens OX=9606 GN=PHACTR1 PE=1 SV=3
4	Q6RFY2	1.01e-113	350	517	0.414	0.464	PHAR3_RAT Phosphatase and actin regulator 3 OS=Rattus norvegicus OX=10116 GN=Phactr3 PE=1 SV=1
5	Q96KR7	2.28e-85	278	559	0.290	0.301	PHAR3_HUMAN Phosphatase and actin regulator 3 OS=Homo sapiens OX=9606 GN=PHACTR3 PE=1 SV=1
6	O75167	2.46e-71	243	634	0.221	0.202	PHAR2_HUMAN Phosphatase and actin regulator 2 OS=Homo sapiens OX=9606 GN=PHACTR2 PE=1 SV=2
7	Q501J7	7.58e-71	243	694	0.291	0.244	PHAR4_MOUSE Phosphatase and actin regulator 4 OS=Mus musculus OX=10090 GN=Phactr4 PE=1 SV=2
8	Q8IDX6	0.30	36.6	3130	0.052	0.010	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
9	A0A0G2K3Y9	0.50	35.8	1028	0.062	0.035	A0A0G2K3Y9_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=4 SV=2
10	A0A0G2JXC5	0.51	35.8	1038	0.062	0.035	A0A0G2JXC5_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
11	A0A8I5Y2C3	0.52	35.8	978	0.062	0.037	A0A8I5Y2C3_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
12	A0A8I6AI47	1.2	34.7	992	0.060	0.035	A0A8I6AI47_RAT Myocardin related transcription factor A OS=Rattus norvegicus OX=10116 GN=Mrtfa PE=1 SV=1
13	Q9VJJ7	2.8	33.5	1128	0.047	0.024	TRPG_DROME Transient receptor potential-gamma protein OS=Drosophila melanogaster OX=7227 GN=Trpgamma PE=1 SV=2
14	B7Z0R2	4.9	32.7	2002	0.050	0.014	B7Z0R2_DROME Sponge, isoform D OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=2
15	A0A0B4KHD2	5.1	32.7	2008	0.050	0.014	A0A0B4KHD2_DROME Sponge, isoform F OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=1
16	Q9VAS8	5.4	32.7	2187	0.050	0.013	Q9VAS8_DROME Sponge, isoform E OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=5
17	A0A087WU73	6.8	32.3	882	0.036	0.024	A0A087WU73_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
18	Q969V6	7.3	32.0	931	0.036	0.023	MRTFA_HUMAN Myocardin-related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=1
19	H7C5E5	7.5	31.2	218	0.043	0.115	H7C5E5_HUMAN Transcription factor AP-2 alpha (Fragment) OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
20	B0QY83	7.8	32.0	981	0.036	0.021	B0QY83_HUMAN Myocardin related transcription factor A OS=Homo sapiens OX=9606 GN=MRTFA PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02755 RPEL	4.6e-28	107.3	RPEL repeat
2	PF09055 Sod_Ni	3.5e+02	13.2	Nickel-containing superoxide dismutase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329880

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355645	0.888	Actin, alpha skeletal muscle
2	9606.ENSP00000326031	0.855	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
3	9606.ENSP00000378769	0.803	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
4	9606.ENSP00000347847	0.781	MKL/myocardin-like protein 1
5	9606.ENSP00000339086	0.766	MKL/myocardin-like protein 2
6	9606.ENSP00000290378	0.716	Actin, alpha cardiac muscle 1
7	9606.ENSP00000368589	0.698	Belongs to the Gfo/Idh/MocA family
8	9606.ENSP00000368698	0.679	Zinc finger protein 40
9	9606.ENSP00000261015	0.652	Ribosome biogenesis protein WDR12
10	9606.ENSP00000265354	0.615	Serum response factor
11	9606.ENSP00000382250	0.609	Mitochondrial ribosomal protein S6
12	9606.ENSP00000401678	0.607	Myocardin
13	9606.ENSP00000340900	0.603	Transport and Golgi organization protein 1 homolog
14	9606.ENSP00000358925	0.602	Proline/serine-rich coiled-coil protein 1
15	9606.ENSP00000475727	0.585	TBC1 domain family member 7
16	9606.ENSP00000338864	0.574	RAS guanyl-releasing protein 2
17	9606.ENSP00000481038	0.552	Cytoplasmic FMR1-interacting protein 1
18	9606.ENSP00000476228	0.550	NAD-dependent protein deacylase sirtuin-5, mitochondrial
19	9606.ENSP00000268797	0.536	Glucose-fructose oxidoreductase domain-containing protein 2
20	9606.ENSP00000469981	0.536	Tafazzin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0019899	0.927	enzyme binding
GO:0008157	0.898	protein phosphatase 1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030029	0.995	actin filament-based process
GO:0097435	0.994	supramolecular fiber organization
GO:0007010	0.992	cytoskeleton organization
GO:0050789	0.987	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0007015	0.946	actin filament organization
GO:0061572	0.931	actin filament bundle organization
GO:0051017	0.914	actin filament bundle assembly
GO:0032501	0.881	multicellular organismal process
GO:0048856	0.879	anatomical structure development
GO:0031032	0.827	actomyosin structure organization
GO:0007275	0.790	multicellular organism development
GO:0019222	0.691	regulation of metabolic process
GO:0031323	0.650	regulation of cellular metabolic process
GO:0060255	0.409	regulation of macromolecule metabolic process
GO:0080090	0.402	regulation of primary metabolic process
GO:0051171	0.401	regulation of nitrogen compound metabolic process
GO:0050896	0.329	response to stimulus
GO:0048518	0.320	positive regulation of biological process
GO:0048522	0.314	positive regulation of cellular process
GO:0048731	0.310	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005737	0.997	cytoplasm
GO:0005829	0.992	cytosol
GO:0070013	0.903	intracellular organelle lumen
GO:0031981	0.719	nuclear lumen
GO:0005654	0.706	nucleoplasm
GO:0030054	0.684	cell junction
GO:0045202	0.574	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]