StarFunc result for job id Q9C0D2

User Input

>input (2601 residues)
MKRKVVNTHKLRLSPNEEAFILKEDYERRRKLRLLQVREQERDIALQIREDIKQRRNQQF
TRLAEELRAEWEESQTQKIQNLEKLYLASLRSMGEGHRQAKENEPDLDALAQRAAERKRK
ADLRHKEALKVQKNQKEILLKQKTWHIKARKEALLVEKERSAKITSLPPPPPTLFENIEV
KRISAVKTNSSTYHHLHTFVNRETDTKRPDARLAAEEEAKRLEELQKQAAQERMERFEKA
HVRGFQAMKKIHLAQNQEKLMKELKQLQQEDLARRRQTVAQMPPQLVELPYKRSEMKEDW
QRELEFAFEDMYNADRKVKGNLILHLEPEPLPTVTNQIQDEELDLSMEQENLGAAEDLPV
TEAEICSSETDVPLVMKTQQIPSKVLFKKLLNKIRSQKSLWTIKSMSEDESEMITTVSEI
ESKAPTVESGTIASKERTLSSGQEQVVESDTLTIESGPLASEDKPLSCGTNSGKEQEINE
TLPITTVAQSSVLLHPQEAAARIRMSARQKQIMEIEEQKQKQLELLEQIEQQKLRLETDC
FRAQLEEEKRKKTQPTGVGIAPASCPVISDEDSHRQMIRNYQHQLLQQNRLHRQSVETAR
KQLLEYQTMLKGRCPSVSAPSLITDSVISVPSWKSERPTAISEHWDQGQRLKLSPNKYQP
IQPIQTSKLEQDHFQVARQNHFPQRQVETTETLRASDILTNQALESQEHLRQFSQTETQQ
RDYKLVPKDSETLSRALSHDRQLISQDARKISETFGATTFQSLESQQLFSENSENISYHL
TEPSSFVPLVPQHSFSSLPVKVESGKIQEPFSAMSKSTVSTSHSIISQMHDRPLLPSENI
TAQQGNMKALQEQLDLQKKVLQATQEAQEQLLLCKQKEVEQQTGLSVFLPLVTPDSSALL
PSAKADLGRIQESSPTKNNIAVSSDHHVISQLQDKRLSLSQPILSQQNNFKFLQEQLNIQ
KDSLQARREAQEVLYVHKQSELDRRVCSEQAEPSFPFQVAQHTFTSLPSADTKSGKIQEQ
HSSKSEKGLVSCQSDIPISQDGSLSFLQQFLPLHDSLKLLQEQLTKQRDTLQARHEAQVE
LLLHRQRDLGDSKSGLVSSSSSPVVVQHSVASQASAKAEPRRIQELYLSEKENVGPSCHL
IIPTFQDKSLSFPQHSLAQQENLTILQEQSQIQRVILGAKEGTQEFVHTESELEKRISSE
QTGTSSSLSQVDESERFQECISIKSDSTIPLSHPKIPRCQERLLRVSQHMLPLQDNLEEH
QAWLDTEKEAFHFSQKTQENTSSEQTGSSSFIPQLVQLSFTSLASAESGTILEPLFTESE
SKIFSSHLQIPQLQDRLLRISQLIQPQQDNLKALQEQLATQREAIILARQEAREELLLHQ
SEWEGRISPEQVDTSSLPLVPQHSFASLPLNESERNQEPCSINSDNIVSSGHSEIPTLPD
GLLGLSHLVLPQQDNLIALEEHLHAQTDFLPSIEKTQKELVLSKPCKFEEKVSSEHFIQS
HHGDLQALQQQLDTQKKAIRSIQEVQEELLLQRLSELEKRVSSEQVCSSSFVSQVPVADS
ERTQKSFPTKSNDTLPSSHREIPRLQDRLLSLSKPILPQQDNMTAQLDAQREVMYSYEKP
QEELSLNKQRKLNKSESAEHTIPSLFLPKETEHSFIPLPFAEAKPKSTCELYSSQNEHAA
PPSNPVIPGFQDRLLSFSQSVLTQQDNLGLQKQLDLQREVLHYSQKAQEKLLVQRQTALQ
QQIQKHEETLKDFFKDSQISKPTVENDLKTQKMGQLRDWFPNTQDLAGNDQENIRHADRN
NSDDNHLASEDTSAKQSGEHLEKDLGRRSSKPPVAKVKCGLDLNQHELSAIQEVESPAIG
RTSILGKPGIYEDRDPLRVSISREQSFFGSPLAHDPFSCLQLVGQENVCGDDYDEAVKLK
ESVVENHAVLSYAVEEEHAYLGPTVKPDDKAKTLSYEPLSSATVSTGSLLSYENTDLSLT
DPESFSEHMDDSKQESTTSKEEETNIISSIVPSTQDIYQRQNSSDVHKSLLPAVDETTCG
HTHFQQMIDKYINEANLIPEKTDLQELEHIFPNLHHQLFKPLEPHPDFDLSSSSSGISPD
NRDFYQRSDSSSESHCATGLSKSTVYFTALRRTSMHSSLNTSPNQQPDTNLAHVGAHSFA
TENIIGGSEQCFEQLQPEYSSQEESQHADLPSIFSIEARDSSQGMKNQNYPSEEHTEILQ
NKKKIVHFQLSIGNLSSVYSSSDEANVFDQLNVQHSTPCGSNSSECSTKHQLESRKESMG
FEELSKRGVVTMLQSQGLIEDNKNETCRVLDINPQVEETDSRLCVRTVEMGTSIQAPYSL
TTQNEKYFENSAETDIPKITKKLSQLGESELFASSGSFSLQSSIPVWETETGHGIMEEPE
LTLISTTDTSIAEMDFANLTLEEKSENEAKCFFQVSEFLPLVSATEASDYPAVSELSIEK
PRTASTETPRRLTPVPGSLQEAFIKRKKSFMERSHQRQKEIRNKIHVSENSQIKTVKEKP
SISSSVSRLKGVNKVRASFPEDRKTTQALRHQRGLRLYNQLAEVKQQKEEKTKQEAYAQN
RARAKEFHKKTLEKLRAKNTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0D2	1.000	1.000	0.000	2601	1.000	1.000	Q9C0D2.pdb.gz	CE295_HUMAN Centrosomal protein of 295 kDa OS=Homo sapiens OX=9606 GN=CEP295 PE=1 SV=4
2	AFDB:P21263	0.034	0.044	1.936E-6	1893	0.123	0.169	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
3	AFDB:Q6P5H2	0.036	0.047	2.566E-6	1864	0.121	0.168	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
4	AFDB:P48681	0.043	0.059	5.188E-6	1621	0.111	0.178	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
5	AFDB:P48634	0.028	0.031	1.977E-5	2157	0.119	0.144	P48634.pdb.gz	PRC2A_HUMAN Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3
6	AFDB:Q86BG1	0.037	0.079	4.290E-5	1069	0.048	0.117	Q86BG1.pdb.gz	Q86BG1_DROME Ankyrin-repeat, SH3-domain, and Proline-rich-region containing protein, isoform B OS=Drosophila melanogaster OX=7227 GN=ASPP PE=4 SV=1
7	AFDB:Q9VU86	0.027	0.030	9.988E-5	1873	0.089	0.123	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
8	AFDB:Q9BVV6	0.030	0.048	2.325E-4	1533	0.088	0.149	Q9BVV6.pdb.gz	TALD3_HUMAN Protein TALPID3 OS=Homo sapiens OX=9606 GN=KIAA0586 PE=1 SV=4
9	AFDB:Q5PR69	0.027	0.050	2.872E-4	1207	0.073	0.157	Q5PR69.pdb.gz	CRACD_MOUSE Capping protein-inhibiting regulator of actin dynamics OS=Mus musculus OX=10090 GN=Cracd PE=1 SV=4
10	AFDB:Q9PVV4	0.034	0.041	3.548E-4	2031	0.103	0.132	Q9PVV4.pdb.gz	PCM1_XENLA Pericentriolar material 1 protein OS=Xenopus laevis OX=8355 GN=pcm1 PE=1 SV=1
11	PDB:6n8jb	0.018	0.045	6.205	647	0.012	0.048	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
12	PDB:7mqaNA	0.018	0.097	6.658	295	0.016	0.139	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7rroF1	0.020	0.115	8.224	421	0.006	0.038	7rroF1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C0D2	0.0	5299	2601	1.000	1.000	CE295_HUMAN Centrosomal protein of 295 kDa OS=Homo sapiens OX=9606 GN=CEP295 PE=1 SV=4
2	Q497N6	2.31e-19	97.1	533	0.061	0.296	C295L_MOUSE CEP295 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cep295nl PE=1 SV=1
3	Q9VC64	0.023	42.7	1729	0.015	0.023	Q9VC64_DROME Anastral spindle 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ana1 PE=1 SV=1
4	Q9QXL1	0.067	41.2	1668	0.029	0.045	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
5	Q96M02	0.12	40.4	699	0.018	0.066	CJ090_HUMAN (E2-independent) E3 ubiquitin-conjugating enzyme FATS OS=Homo sapiens OX=9606 GN=C10orf90 PE=2 SV=2
6	Q9ULD2	0.20	39.7	1270	0.013	0.028	MTUS1_HUMAN Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2
7	S4R3N7	0.20	39.7	796	0.018	0.058	S4R3N7_HUMAN Chromosome 10 open reading frame 90 OS=Homo sapiens OX=9606 GN=C10orf90 PE=1 SV=3
8	Q8TCU4	2.4	36.2	4168	0.006	0.004	ALMS1_HUMAN Centrosome-associated protein ALMS1 OS=Homo sapiens OX=9606 GN=ALMS1 PE=1 SV=4
9	D2J0Y4	3.3	35.4	644	0.015	0.059	CJ090_MOUSE (E2-independent) E3 ubiquitin-conjugating enzyme FATS OS=Mus musculus OX=10090 GN=D7Ertd443e PE=1 SV=1
10	Q5T025	5.6	34.7	660	0.018	0.070	Q5T025_HUMAN Chromosome 10 open reading frame 90 OS=Homo sapiens OX=9606 GN=C10orf90 PE=1 SV=2
11	O75037	8.6	34.3	1637	0.018	0.028	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15309 ALMS_motif	0.0014	30.4	ALMS motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316681

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257287	0.911	Centrosomal protein of 135 kDa
2	9606.ENSP00000370337	0.860	Centrosomal protein of 152 kDa
3	9606.ENSP00000287482	0.843	Spindle assembly abnormal protein 6 homolog
4	9606.ENSP00000295872	0.767	Spindle and centriole-associated protein 1
5	9606.ENSP00000342510	0.765	Centrosomal protein of 97 kDa
6	9606.ENSP00000292330	0.753	Protein phosphatase 1 regulatory subunit 35
7	9606.ENSP00000389427	0.734	Centrosomal protein 44
8	9606.ENSP00000255674	0.721	Rotatin
9	9606.ENSP00000371308	0.718	Centromere protein J
10	9606.ENSP00000270861	0.696	Serine/threonine-protein kinase PLK4
11	9606.ENSP00000343818	0.696	CDK5 regulatory subunit-associated protein 2
12	9606.ENSP00000303058	0.695	Centrosomal protein of 120 kDa
13	9606.ENSP00000366690	0.694	Speriolin
14	9606.ENSP00000323302	0.693	POC1 centriolar protein homolog B
15	9606.ENSP00000369614	0.681	Centrobin
16	9606.ENSP00000370803	0.679	Centriolar coiled-coil protein of 110 kDa
17	9606.ENSP00000360944	0.663	SCL-interrupting locus protein
18	9606.ENSP00000410216	0.611	Centrosomal protein POC5
19	9606.ENSP00000427550	0.566	Centrosomal protein of 192 kDa
20	9606.ENSP00000385215	0.563	Centrosomal protein of 162 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008017	1.000	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007099	0.988	centriole replication
GO:0032886	0.986	regulation of microtubule-based process
GO:0010564	0.979	regulation of cell cycle process
GO:1902115	0.979	regulation of organelle assembly
GO:0010638	0.973	positive regulation of organelle organization
GO:0051493	0.962	regulation of cytoskeleton organization
GO:0044089	0.955	positive regulation of cellular component biogenesis
GO:0010824	0.938	regulation of centrosome duplication
GO:1902117	0.900	positive regulation of organelle assembly
GO:0051495	0.871	positive regulation of cytoskeleton organization
GO:0051171	0.834	regulation of nitrogen compound metabolic process
GO:0080090	0.832	regulation of primary metabolic process
GO:0060255	0.832	regulation of macromolecule metabolic process
GO:0045787	0.825	positive regulation of cell cycle
GO:0032879	0.717	regulation of localization
GO:0060341	0.655	regulation of cellular localization
GO:0031399	0.625	regulation of protein modification process
GO:1901983	0.590	regulation of protein acetylation
GO:0051173	0.581	positive regulation of nitrogen compound metabolic process
GO:0010604	0.578	positive regulation of macromolecule metabolic process
GO:0031401	0.559	positive regulation of protein modification process
GO:0032880	0.544	regulation of protein localization
GO:1901985	0.511	positive regulation of protein acetylation
GO:0090068	0.413	positive regulation of cell cycle process
GO:1903829	0.396	positive regulation of protein localization
GO:0070201	0.368	regulation of establishment of protein localization
GO:1904951	0.363	positive regulation of establishment of protein localization
GO:0046601	0.309	positive regulation of centriole replication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005813	0.999	centrosome
GO:0005819	0.998	spindle
GO:0005886	0.997	plasma membrane
GO:0005814	0.997	centriole
GO:0005874	0.997	microtubule
GO:1990498	0.992	mitotic spindle microtubule
GO:0043227	0.684	membrane-bounded organelle
GO:0043233	0.476	organelle lumen
GO:0031981	0.470	nuclear lumen
GO:0005654	0.412	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]