StarFunc result for job id Q9C0D4

User Input

>input (1074 residues)
MKDIGQQLYTTHLNGGHNSLTMSPKQPDANGAPRPNRQEAQTLLYQGSEAEAAMMTIATC
AKCKSVHKISLQDLQKGTGKDGMYVCFQCSLGAAPPNFHFVSNNSSATHVGNKTENFSSS
VNSKFKVRNFKPGKYYCDKCRFSTKDPLQYKKHTLQHEEIKFICSHCSYISYTKGEFQRH
LVKHTGIFPYQCEYCDYGAIRNDYIVKHTKRVHERAGAKRPVKAVAKLEPKRTGTSKQNP
ELLKASNPRTTFQNKWSDQLSGFSLHANKDKMHNIMLLPEPKEYQKDVVCIPNKMTLSEP
NEVNLFENKNVEVEVLSPAKEPVQPGMPLTVVAPAELVVPANCLAQLIDVKVVNGTQQLV
LKLFPLEENNCLEAGRDNGGNSERMVKEKGSNEQEKVLSAEKTKSLTVDGNVGKLVGIDS
FQPSVQKQLKNVKWVRSYDFIMPNSSVHNNGKSFINSETIEDFQKKNNLYPHRTAFPSVA
LKGHSLASVFKNSVLRSLGAASNPFPYKAAVCFAESGRNLHSSSQQLLPFAASPATCSFS
GEKGLLPVSENDLESTSKVNIPVKVVSSNRKQEDNQTEEHKAVSTVGQISSQHKSEYLHI
NITGEDRSQQPGDKPLELKNSERTNNTNDGPVISSVFSLSSGSENVPEGIKWNSSTSKIK
SIELLRRKIAQLIESCGKPSSLASNSAHRRSVGQASKGTSKATSEGIQEINVSLTGLGHS
TGTLQKPPNDGGITGNRQLTHQQIYPHFADGSNRKTKSRVARKAHVATPVLIPKGAVLRV
LNSSENAHIIEATCEAPVSIPCSERQLIKPVPFCPVRQADSDLQPLRSERGPIDMSPNIE
TPLRPKLRKESAVCSTIHRKTGLLYGQQGSSELNKQGRLLSRSLSISRNKTKQVHLSRKK
NKIQAEPSRCLKDPSIFQVARQLRLIAAKPDQLIKCPRRNQPVIVLNHPDVDSPEVTNVM
KVINKYKGNVLKVVLSERTRCQLGIRRHHVRLTYQNAEEASQIKRQMMLKMKLKKVHKNN
YQVVDSLPDDSSQCVFKCWFCGRLYEDQEEWMSHGQRHLIEATRDWDVLSSKGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1W2PQA1	0.063	0.063	1.050E-9	1069	0.146	0.147	A0A1W2PQA1.pdb.gz	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
2	AFDB:Q0GGX2	0.081	0.068	1.981E-7	1363	0.164	0.129	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
3	AFDB:Q9P1Z0	0.084	0.088	9.421E-7	1013	0.119	0.126	Q9P1Z0.pdb.gz	ZBTB4_HUMAN Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3
4	AFDB:Q9H0D2	0.072	0.060	1.209E-6	1346	0.155	0.124	Q9H0D2.pdb.gz	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
5	AFDB:Q9GV71	0.043	0.033	4.505E-5	1543	0.127	0.088	Q9GV71.pdb.gz	Q9GV71_DICDI MAP kinase phosphatase OS=Dictyostelium discoideum OX=44689 GN=mkpA PE=4 SV=1
6	AFDB:O75362	0.054	0.055	1.670E-4	1048	0.112	0.115	O75362.pdb.gz	ZN217_HUMAN Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1
7	AFDB:Q4LE39	0.043	0.037	2.440E-3	1312	0.101	0.083	Q4LE39.pdb.gz	ARI4B_HUMAN AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B PE=1 SV=2
8	AFDB:F1QH64	0.068	0.061	3.132E-3	1225	0.132	0.116	F1QH64.pdb.gz
9	AFDB:Q9VXE6	0.038	0.026	3.132E-3	1883	0.121	0.069	Q9VXE6.pdb.gz	NU153_DROME Nuclear pore complex protein Nup153 OS=Drosophila melanogaster OX=7227 GN=Nup153 PE=1 SV=4
10	AFDB:P14404	0.065	0.058	5.159E-3	1232	0.122	0.106	P14404.pdb.gz	MECOM_MOUSE Histone-lysine N-methyltransferase MECOM OS=Mus musculus OX=10090 GN=Mecom PE=1 SV=2
11	PDB:3w5kB	0.042	0.235	4.697E-2	110	0.019	0.182	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4z4kA	0.030	0.084	1.131	282	0.012	0.046	4z4kA.pdb.gz	A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.
13	PDB:7pmkQ	0.023	0.029	1.644	766	0.012	0.017	7pmkQ.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
14	PDB:6sgaFd	0.029	0.266	2.883	96	0.008	0.094	6sgaFd.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
15	PDB:5ondA	0.018	0.107	3.266	135	0.007	0.059	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
16	PDB:6ff79	0.040	0.077	3.266	432	0.015	0.037	6ff79.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:6tdaL	0.034	0.049	3.266	596	0.016	0.029	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
18	PDB:6yxxBW	0.034	0.130	3.700	188	0.008	0.048	6yxxBW.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
19	PDB:6k15H	0.030	0.058	3.938	393	0.012	0.033	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
20	PDB:7pfoB	0.019	0.026	3.938	759	0.008	0.012	7pfoB.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2EI20	1.11e-08	62.0	855	0.029	0.036	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
2	Q9H4Z2	1.44e-08	61.6	1342	0.027	0.022	ZN335_HUMAN Zinc finger protein 335 OS=Homo sapiens OX=9606 GN=ZNF335 PE=1 SV=1
3	Q9UL36	2.21e-08	61.2	1845	0.031	0.018	ZN236_HUMAN Zinc finger protein 236 OS=Homo sapiens OX=9606 GN=ZNF236 PE=1 SV=2
4	O54963	5.09e-08	59.7	1069	0.027	0.027	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
5	A2A5K6	1.10e-07	58.9	1337	0.034	0.028	ZN335_MOUSE Zinc finger protein 335 OS=Mus musculus OX=10090 GN=Znf335 PE=1 SV=1
6	Q8VIG1	1.17e-07	58.5	1082	0.027	0.027	REST_MOUSE RE1-silencing transcription factor OS=Mus musculus OX=10090 GN=Rest PE=1 SV=2
7	A0A1W2PQA1	1.21e-07	58.5	1069	0.023	0.023	A0A1W2PQA1_HUMAN RE1 silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=2
8	G3V893	1.32e-07	58.5	1336	0.025	0.020	ZN335_RAT Zinc finger protein 335 OS=Rattus norvegicus OX=10116 GN=Znf335 PE=1 SV=1
9	Q13127	1.72e-07	58.2	1097	0.027	0.026	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
10	Q9EPT3	2.82e-07	57.0	675	0.035	0.056	Q9EPT3_MOUSE Lost on transformation protein 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
11	O35745	3.36e-07	57.0	667	0.035	0.057	O35745_MOUSE Zinc finger protein OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
12	B7ZP38	3.38e-07	57.0	678	0.035	0.056	B7ZP38_MOUSE Plagl1 protein OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
13	Q3UQW2	3.41e-07	57.0	678	0.035	0.056	Q3UQW2_MOUSE Pleiomorphic adenoma gene-like 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
14	Q3UQR2	3.47e-07	57.0	678	0.035	0.056	Q3UQR2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
15	Q9JLQ4	3.66e-07	56.6	704	0.035	0.054	Q9JLQ4_MOUSE Pleiomorphic adenoma gene-like 1 OS=Mus musculus OX=10090 GN=Plagl1 PE=2 SV=1
16	Q8VCZ7	5.92e-07	55.8	619	0.029	0.050	ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus OX=10090 GN=Zbtb7c PE=2 SV=1
17	A1YPR0	6.84e-07	55.8	619	0.027	0.047	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
18	P08048	1.50e-06	54.7	801	0.028	0.037	ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFY PE=1 SV=3
19	Q9VEF0	2.10e-06	53.9	430	0.026	0.065	Q9VEF0_DROME LD33778p OS=Drosophila melanogaster OX=7227 GN=Odj PE=1 SV=2
20	P17012	2.45e-06	54.3	799	0.027	0.036	ZFX_MOUSE Zinc finger X-chromosomal protein OS=Mus musculus OX=10090 GN=Zfx PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12406 DUF3664	6.5e+02	12.4	Surface protein
2	PF00096 zf-C2H2	3.5	19.4	Zinc finger, C2H2 type
3	PF13894 zf-C2H2_4	1.1e+02	15.1	C2H2-type zinc finger
4	PF13465 zf-H2C2_2	0.077	24.7	Zinc-finger double domain
5	PF13909 zf-H2C2_5	0.0011	30.0	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317614

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427687	0.766	WD repeat-containing protein 1
2	9606.ENSP00000216410	0.754	Glucosamine-phosphate N-acetyltransferase 1
3	9606.ENSP00000362562	0.717	Transmembrane protein 54
4	9606.ENSP00000304769	0.700	Zinc finger protein 467
5	9606.ENSP00000278826	0.686	Transmembrane protein 138
6	9606.ENSP00000397566	0.685	General transcription factor II-I repeat domain-containing protein 1
7	9606.ENSP00000392700	0.668	APC membrane recruitment protein 3
8	9606.ENSP00000199448	0.636	Mammalian ependymin-related protein 1
9	9606.ENSP00000349291	0.546	TBC1 domain family member 9B
10	9606.ENSP00000320147	0.534	Histone-lysine N-methyltransferase EZH2
11	9606.ENSP00000308944	0.528	Helicase-like transcription factor
12	9606.ENSP00000264784	0.516	Solute carrier family 2, facilitated glucose transporter member 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.991	nucleic acid binding
GO:0003677	0.982	DNA binding
GO:0043565	0.726	sequence-specific DNA binding
GO:0140110	0.683	transcription regulator activity
GO:0003700	0.600	DNA-binding transcription factor activity
GO:0003690	0.569	double-stranded DNA binding
GO:1990837	0.540	sequence-specific double-stranded DNA binding
GO:0001067	0.455	transcription regulatory region nucleic acid binding
GO:0000976	0.442	transcription cis-regulatory region binding
GO:0000981	0.324	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0080090	0.959	regulation of primary metabolic process
GO:0010468	0.953	regulation of gene expression
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0009987	0.944	cellular process
GO:0031323	0.911	regulation of cellular metabolic process
GO:0019219	0.806	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.739	negative regulation of biological process
GO:0051252	0.718	regulation of RNA metabolic process
GO:0048523	0.631	negative regulation of cellular process
GO:0031326	0.417	regulation of cellular biosynthetic process
GO:2001141	0.381	regulation of RNA biosynthetic process
GO:0006355	0.372	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.998	nucleus
GO:0005654	0.991	nucleoplasm
GO:0005737	0.943	cytoplasm
GO:0043228	0.936	non-membrane-bounded organelle
GO:0043232	0.919	intracellular non-membrane-bounded organelle
GO:0005829	0.886	cytosol
GO:0000803	0.392	sex chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]