StarFunc result for job id Q9C0D5

User Input

>input (1861 residues)
MLKAVLKKSREGGKGGKKEAGSDFGPETSPVLHLDHSADSPVSSLPTAEDTYRVSLAKGV
SMSLPSSPLLPRQSHLVQSRVNKKSPGPVRKPKYVESPRVPGDAVIMPFREVAKPTEPDE
HEAKADNEPSCSPAAQELLTRLGFLLGEGIPSATHITIEDKNETMCTALSQGISPCSTLT
SSTASPSTDSPCSTLNSCVSKTAANKSPCETISSPSSTLESKDSGIIATITSSSENDDRS
GSSLEWNKDGNLRLGVQKGVLHDRRADNCSPVAEEETTGSAESTLPKAESSAGDGPVPYS
QGSSSLIMPRPNSVAATSSTKLEDLSYLDGQRNAPLRTSIRLPWHNTAGGRAQEVKARFA
PYKPQDILLKPLLFEVPSITTDSVFVGRDWLFHQIEENLRNTELAENRGAVVVGNVGFGK
TAIISKLVALSCHGSRMRQIASNSPGSSPKTSDPTQDLHFTPLLSPSSSTSASSTAKTPL
GSISAENQRPREDAVKYLASKVVAYHYCQADNTYTCLVPEFVHSIAALLCRSHQLAAYRD
LLIKEPQLQSMLSLRSCVQDPVAAFKRGVLEPLTNLRNEQKIPEEEYIILIDGLNEAEFH
KPDYGDTLSSFITKIISKFPAWLKLIVTVRANFQEIISALPFVKLSLDDFPDNKDIHSDL
HAYVQHRVHSSQDILSNISLNGKADATLIGKVSSHLVLRSLGSYLYLKLTLDLFQRGHLV
IKSASYKVVPVSLSELYLLQCNMKFMTQSAFERALPILNVALASLHPMTDEQIFQAINAG
HIQGEQGWEDFQQRMDALSCFLIKRRDKTRMFCHPSFREWLVWRADGENTAFLCEPRNGH
ALLAFMFSRQEGKLNRQQTMELGHHILKAHIFKGLSKKTGISSSHLQALWIGYSTEGLSA
ALASLRNLYTPNVKVSRLLILGGANVNYRTEVLNNAPILCVQSHLGHEEVVTLLLEFGAC
LDGTSENGMTALCYAAAAGHMKLVCLLTKKGVRVDHLDKKGQCALVHSALRGHGDILQYL
LTCEWSPGPPQPGTLRKSHALQQALTAAASMGHSSVVQCLLGMEKEHEVEVNGTDTLWGE
TALTAAAGRGKLEVCELLLGHGAAVSRTNRRGVPPLFCAARQGHWQIVRLLLERGCDVNL
SDKQGRTPLMVAACEGHLSTVEFLLSKGAALSSLDKEGLSALSWACLKGHRAVVQYLVEE
GAAIDQTDKNGRTPLDLAAFYGDAETVLYLVEKGAVIEHVDHSGMRPLDRAIGCRNTSVV
VALLRKGAKLGNAAWAMATSKPDILIILLQKLMEEGNVMYKKGKMKEAAQRYQYALRKFP
REGFGEDMRPFNELRVSLYLNLSRCRRKTNDFGMAEEFASKALELKPKSYEAFYARARAK
RNSRQFVAALADLQEAVKLCPTNQEVKRLLARVEEECKQLQRSQQQKQQGPLPAPLNDSE
NEEDTPTPGLSDHFHSEETEEEETSPQEESVSPTPRSQPSSSVPSSYIRNLQEGLQSKGR
PVSPQSRAGIGKSLREPVAQPGLLLQPSKQAQIVKTSQHLGSGQSAVRNGSMKVQISSQN
PPPSPMPGRIAATPAGSRTQHLEGTGTFTTRAGCGHFGDRLGPSQNVRLQCGENGPAHPL
PSKTKTTERLLSHSSVAVDAAPPNQGGLATCSDVRHPASLTSSGSSGSPSSSIKMSSSTS
SLTSSSSFSDGFKVQGPDTRIKDKVVTHVQSGTAEHRPRNTPFMGIMDKTARFQQQSNPP
SRSWHCPAPEGLLTNTSSAAGLQSANTEKPSLMQVGGYNNQAKTCSVSTLSASVHNGAQV
KELEESKCQIPVHSQENRITKTVSHLYQESISKQQPHISNEAHRSHLTAAKPKRSFIESN
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A690	0.547	0.512	0.000	1994	0.517	0.483	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
2	AFDB:Q9C0D5	1.000	1.000	0.000	1861	1.000	1.000	Q9C0D5.pdb.gz	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
3	PDB:8cs9A	0.191	0.409	1.410E-17	796	0.074	0.173	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	PDB:5vkqA	0.188	0.221	5.512E-14	1499	0.084	0.105	5vkqA.pdb.gz
5	PDB:4oauC	0.127	0.298	2.075E-10	692	0.048	0.130	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
6	AFDB:Q8WXD9	0.126	0.163	3.348E-9	1431	0.092	0.119	Q8WXD9.pdb.gz	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
7	PDB:2dvwA	0.110	0.805	2.011E-8	229	0.036	0.293	2dvwA.pdb.gz
8	AFDB:Q8N2N9	0.103	0.139	1.075E-7	1353	0.066	0.091	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
9	PDB:1wg0A	0.109	0.754	5.542E-7	243	0.033	0.251	1wg0A.pdb.gz
10	PDB:6v9hC	0.108	0.670	5.757E-7	270	0.033	0.230	6v9hC.pdb.gz
11	AFDB:A0A0G2K889	0.130	0.179	1.058E-6	1289	0.098	0.142	A0A0G2K889.pdb.gz	A0A0G2K889_RAT Euchromatic histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ehmt1 PE=1 SV=2
12	AFDB:F4HS99	0.073	0.075	1.280E-6	1797	0.074	0.077	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
13	PDB:6mwqA	0.078	0.288	1.611E-6	493	0.031	0.116	6mwqA.pdb.gz
14	AFDB:Q5ADP3	0.072	0.113	1.672E-6	1080	0.093	0.160	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
15	PDB:6aunA	0.106	0.243	2.186E-6	618	0.043	0.129	6aunA.pdb.gz
16	AFDB:Q6DRG7	0.064	0.110	2.641E-6	1049	0.079	0.140	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
17	PDB:6jd6B	0.086	0.782	2.645E-6	192	0.024	0.229	6jd6B.pdb.gz
18	AFDB:A2ABF8	0.101	0.140	3.867E-6	1233	0.092	0.139	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
19	PDB:1ihgA	0.078	0.373	4.178E-6	364	0.020	0.104	1ihgA.pdb.gz
20	AFDB:Q9H9B1	0.125	0.171	5.661E-6	1298	0.097	0.139	Q9H9B1.pdb.gz	EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A690	0.0	1722	1994	0.462	0.431	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
2	F1LTE0	0.0	1716	1992	0.466	0.436	TANC2_RAT Protein TANC2 OS=Rattus norvegicus OX=10116 GN=Tanc2 PE=1 SV=2
3	M9PC91	0.0	864	1798	0.255	0.264	M9PC91_DROME Rolling pebbles, isoform I OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=1
4	M9PF75	0.0	864	1799	0.255	0.263	M9PF75_DROME Rolling pebbles, isoform G OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=1
5	M9PFC6	0.0	862	1669	0.255	0.284	M9PFC6_DROME Rolling pebbles, isoform F OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=1
6	M9PI28	0.0	860	1568	0.255	0.302	M9PI28_DROME Rolling pebbles, isoform H OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=1
7	Q0VGY8	0.0	3239	1856	0.895	0.898	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
8	Q6F6B3	0.0	3200	1849	0.880	0.886	TANC1_RAT Protein TANC1 OS=Rattus norvegicus OX=10116 GN=Tanc1 PE=1 SV=1
9	Q8WS23	0.0	862	1670	0.255	0.284	Q8WS23_DROME Rolling pebbles isoform 6 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=1
10	Q8WS24	0.0	865	1900	0.255	0.249	Q8WS24_DROME Rolling pebbles isoform 7 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=1
11	Q8WTD1	0.0	861	1569	0.255	0.302	Q8WTD1_DROME Rolling pebbles isoform 6 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=1
12	Q8WTD2	0.0	865	1900	0.255	0.249	Q8WTD2_DROME Rolling pebbles isoform 7 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=1
13	Q9C0D5	0.0	3843	1861	1.000	1.000	TANC1_HUMAN Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3
14	Q9HCD6	0.0	1743	1990	0.475	0.444	TANC2_HUMAN Protein TANC2 OS=Homo sapiens OX=9606 GN=TANC2 PE=1 SV=3
15	Q9VTS6	0.0	862	1670	0.255	0.284	Q9VTS6_DROME Antisocial isoform 2 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=2
16	Q9VTS8	0.0	860	1569	0.255	0.302	Q9VTS8_DROME Antisocial isoform 1 OS=Drosophila melanogaster OX=7227 GN=rols PE=2 SV=2
17	Q9VTS9	0.0	865	1900	0.255	0.249	Q9VTS9_DROME Rolling pebbles, isoform B OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=2
18	Q9ULJ7	6.77e-88	319	1429	0.147	0.191	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
19	M9MRX4	1.57e-39	165	13559	0.076	0.010	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	X2JCM1	2.71e-39	164	11634	0.076	0.012	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	5.5	18.8	AAA ATPase domain
2	PF12895 ANAPC3	2.6e+02	13.3	Anaphase-promoting complex, cyclosome, subunit 3
3	PF00023 Ank	3.2e-23	92.3	Ankyrin repeat
4	PF12796 Ank_2	3e-45	164.0	Ankyrin repeats (3 copies)
5	PF13606 Ank_3	1.2e-27	103.7	Ankyrin repeat
6	PF13637 Ank_4	9.9e-41	148.9	Ankyrin repeats (many copies)
7	PF13857 Ank_5	3.5e-27	105.4	Ankyrin repeats (many copies)
8	PF00515 TPR_1	0.4	21.8	Tetratricopeptide repeat
9	PF13414 TPR_11	0.26	22.3	TPR repeat
10	PF13424 TPR_12	83	14.9	Tetratricopeptide repeat
11	PF13428 TPR_14	1	21.3	Tetratricopeptide repeat
12	PF13429 TPR_15	2.6e+02	12.3	Tetratricopeptide repeat
13	PF13432 TPR_16	5.3	19.0	Tetratricopeptide repeat
14	PF13431 TPR_17	14	17.4	Tetratricopeptide repeat
15	PF14559 TPR_19	13	17.7	Tetratricopeptide repeat
16	PF07719 TPR_2	5.1e-06	37.2	Tetratricopeptide repeat
17	PF13181 TPR_8	0.61	21.5	Tetratricopeptide repeat
18	PF13371 TPR_9	0.16	23.4	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263635

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358865	0.826	Alpha-internexin
2	9606.ENSP00000349486	0.804	Protein scribble homolog
3	9606.ENSP00000316377	0.803	Disks large-associated protein 1
4	9606.ENSP00000334382	0.745	Homer protein homolog 1
5	9606.ENSP00000381412	0.708	Calcium/calmodulin-dependent protein kinase type II subunit alpha
6	9606.ENSP00000358867	0.700	Guanine nucleotide-binding protein G(k) subunit alpha
7	9606.ENSP00000382428	0.690	Disks large homolog 4
8	9606.ENSP00000345731	0.684	Disks large homolog 1
9	9606.ENSP00000408295	0.678	Replication factor C subunit 5
10	9606.ENSP00000352138	0.652	Kin of IRRE-like protein 1
11	9606.ENSP00000354896	0.648	Metabotropic glutamate receptor 1
12	9606.ENSP00000349748	0.647	Splicing factor, proline- and glutamine-rich
13	9606.ENSP00000428994	0.643	Glutamate receptor 1
14	9606.ENSP00000435466	0.630	Kin of IRRE-like protein 3
15	9606.ENSP00000055077	0.619	Replication factor C subunit 2
16	9606.ENSP00000364403	0.613	E3 ubiquitin-protein ligase UBR4
17	9606.ENSP00000366330	0.591	Krueppel-like factor 9
18	9606.ENSP00000379901	0.587	Transmembrane protein 106B
19	9606.ENSP00000444810	0.587	Peptidyl-prolyl cis-trans isomerase FKBP5
20	9606.ENSP00000477455	0.581	Glutamate receptor ionotropic, NMDA 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050794	0.955	regulation of cellular process
GO:0032501	0.950	multicellular organismal process
GO:0032502	0.865	developmental process
GO:0048856	0.851	anatomical structure development
GO:0050896	0.749	response to stimulus
GO:0099175	0.712	regulation of postsynapse organization
GO:0016043	0.656	cellular component organization
GO:0048518	0.431	positive regulation of biological process
GO:0007610	0.406	behavior
GO:0048522	0.333	positive regulation of cellular process
GO:0030154	0.324	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0045202	0.999	synapse
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0042995	0.965	cell projection
GO:0120025	0.927	plasma membrane bounded cell projection
GO:0098794	0.927	postsynapse
GO:0043005	0.919	neuron projection
GO:0005737	0.870	cytoplasm
GO:0016020	0.846	membrane
GO:0036477	0.804	somatodendritic compartment
GO:0097447	0.776	dendritic tree
GO:0098978	0.772	glutamatergic synapse
GO:0099572	0.763	postsynaptic specialization
GO:0043227	0.759	membrane-bounded organelle
GO:0098984	0.754	neuron to neuron synapse
GO:0030425	0.754	dendrite
GO:0014069	0.743	postsynaptic density
GO:0099091	0.742	postsynaptic specialization, intracellular component
GO:0099092	0.729	postsynaptic density, intracellular component
GO:0043231	0.713	intracellular membrane-bounded organelle
GO:0043197	0.665	dendritic spine
GO:0071944	0.387	cell periphery
GO:0005886	0.361	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]