StarFunc result for job id Q9C0D6

User Input

>input (1143 residues)
MHVMNCVSLVSDKENGNIATAPGFMIGQTPPPAPPPPPPPPPPSPPCSCSREECPSSPPP
PPPPPLPGEPPIPPPPPGLPPTTHMNGYSHLGKKKRMRSFFWKTIPEEQVRGKTNIWTLA
ARQEHHYQIDTKTIEELFGQQEDTTKSSLPRRGRTLNSSFREAREEITILDAKRSMNIGI
FLKQFKKSPRSIVEDIHQGKSEHYGSETLREFLKFLPESEEVKKLKAFSGDVSKLSLADS
FLYGLIQVPNYSLRIEAMVLKKEFLPSCSSLYTDITVLRTAIKELMSCEELHSILHLVLQ
AGNIMNAGGYAGNAVGFKLSSLLKLADTKANKPGMNLLHFVAQEAQKKDTILLNFSEKLH
HVQKTARLSLENTEAELHLLFVRTKSLKENIQRDGELCQQMEDFLQFAIEKLRELECWKQ
ELQDEAYTLIDFFCEDKKTMKLDECFQIFRDFCTKFNKAVKDNHDREAQELRQLQRLKEQ
EQKQRSWATGELGAFGRSSSENDVELLTKKGAEGLLPFLHPRPISPSSPSYRPPNTRRSR
LSLGPSADRELLTFLESSTGSPEEPNKFHSLPRSSPRQARPTIACLEPAEVRHQDSSFAH
KPQASGGQEEAPNPPSAQAHQLAAAQPENHASAFPRARRQGVSVLRKRYSEPVSLGSAQS
PPLSPLALGIKEHELVTGLAQFNLQGSQGMEETSQLTLSDFSPMELESVGHRGPQSLSAS
SSSLTPMGRDALGSLSPALEDGKAAPDEPGSAALGSVGSSDPENKDPRPLFCISDTTDCS
LTLDCSEGTDSRPRGGDPEEGGEGDGSMSSGVGEMGDSQVSSNPTSSPPGEAPAPVSVDS
EPSCKGGLPRDKPTKRKDVVAPKRGSLKEASPGASKPGSARRSQGAVAKSVRTLTASENE
SMRKVMPITKSSRGAGWRRPELSSRGPSQNPPSSTDTVWSRQNSVRRASTGAEEQRLPRG
SSGSSSTRPGRDVPLQPRGSFKKPSAKPLRNLPRQKPEENKTCRAHSEGPESPKEEPKTP
SVPSVPHELPRVPSFARNTVASSSRSMRTDLPPVAKAPGITRTVSQRQLRVKGDPEDAAP
KDSSTLRRASSARAPKKRPESAEGPSANTEAPLKARGAGERASLRRKDSSRTTLGRILNP
LRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0D6	0.999	0.999	0.000	1143	1.000	1.000	Q9C0D6.pdb.gz	FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2
2	AFDB:Q3ULZ2	0.437	0.435	1.229E-87	1149	0.732	0.728	Q3ULZ2.pdb.gz	FHDC1_MOUSE FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhdc1 PE=1 SV=3
3	AFDB:Q8I3F9	0.295	0.135	4.818E-4	2675	0.078	0.033	Q8I3F9.pdb.gz	Q8I3F9_PLAF7 Formin 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0530900 PE=4 SV=1
4	AFDB:Q9VAS9	0.055	0.032	1.170E-3	2417	0.185	0.087	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
5	AFDB:Q6AWD5	0.066	0.064	4.428E-3	1220	0.132	0.124	Q6AWD5.pdb.gz	Q6AWD5_DROME AT02057p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8176 PE=1 SV=1
6	AFDB:Q21227	0.047	0.052	4.446E-2	1188	0.127	0.122	Q21227.pdb.gz	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2
7	AFDB:Q9NZ56	0.236	0.161	5.802E-2	1722	0.107	0.071	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
8	AFDB:F4HZK4	0.050	0.039	6.628E-2	1608	0.093	0.066	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
9	AFDB:F4JKH6	0.053	0.038	8.274E-2	1819	0.126	0.079	F4JKH6.pdb.gz	REC2_ARATH Protein REDUCED CHLOROPLAST COVERAGE 2 OS=Arabidopsis thaliana OX=3702 GN=REC2 PE=1 SV=1
10	PDB:4abnB	0.041	0.089	9.751E-2	426	0.034	0.092	4abnB.pdb.gz
11	AFDB:O77086	0.045	0.036	1.409E-1	1571	0.150	0.109	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
12	PDB:1qoyA	0.055	0.129	1.661E-1	303	0.032	0.122	1qoyA.pdb.gz
13	PDB:5mkkA	0.063	0.109	1.897E-1	593	0.038	0.074	5mkkA.pdb.gz
14	PDB:7p5jA	0.062	0.124	1.983E-1	399	0.033	0.095	7p5jA.pdb.gz
15	PDB:3axyC	0.067	0.212	2.956E-1	235	0.029	0.140	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
16	PDB:1qqeA	0.048	0.115	3.690E-1	281	0.036	0.146	1qqeA.pdb.gz
17	PDB:6pqpA	0.052	0.080	4.032E-1	615	0.037	0.068	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
18	PDB:1ekuB	0.035	0.089	4.815E-1	254	0.033	0.150	1ekuB.pdb.gz
19	PDB:2btpA	0.063	0.171	5.034E-1	248	0.026	0.121	2btpA.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
20	PDB:6r7iD	0.036	0.082	6.011E-1	407	0.035	0.098	6r7iD.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3ULZ2	0.0	1487	1149	0.726	0.722	FHDC1_MOUSE FH2 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhdc1 PE=1 SV=3
2	Q9C0D6	0.0	2314	1143	1.000	1.000	FHDC1_HUMAN FH2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHDC1 PE=1 SV=2
3	A8JNM1	2.02e-85	307	1717	0.144	0.096	A8JNM1_DROME Formin 3, isoform B OS=Drosophila melanogaster OX=7227 GN=form3 PE=4 SV=1
4	Q86C16	2.78e-85	306	1644	0.144	0.100	Q86C16_DROME Ah1644 protein OS=Drosophila melanogaster OX=7227 GN=form3 PE=2 SV=1
5	Q86NV5	3.03e-62	234	1167	0.103	0.101	Q86NV5_DROME GH12052p (Fragment) OS=Drosophila melanogaster OX=7227 GN=form3 PE=2 SV=1
6	Q27J81	2.66e-50	197	1249	0.107	0.098	INF2_HUMAN Inverted formin-2 OS=Homo sapiens OX=9606 GN=INF2 PE=1 SV=2
7	Q0GNC1	3.93e-49	193	1273	0.109	0.098	INF2_MOUSE Inverted formin-2 OS=Mus musculus OX=10090 GN=Inf2 PE=1 SV=1
8	M9MSM5	2.54e-38	158	1463	0.094	0.073	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
9	Q8IRY0	1.35e-37	155	1153	0.094	0.093	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
10	Q7YZA4	2.34e-37	155	1114	0.094	0.096	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1
11	Q8MT16	2.58e-36	151	1114	0.093	0.095	Q8MT16_DROME RH61354p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
12	Q9TYU9	1.18e-35	149	843	0.093	0.126	EXC6_CAEEL Excretory canal abnormal protein 6 OS=Caenorhabditis elegans OX=6239 GN=exc-6 PE=1 SV=2
13	Q9W5A4	6.27e-34	144	979	0.094	0.109	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2
14	Q9FJX6	1.18e-32	139	899	0.095	0.121	FH6_ARATH Formin-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=FH6 PE=2 SV=1
15	Q5BII2	4.36e-32	138	1011	0.074	0.084	Q5BII2_DROME RE67944p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
16	Q9C6S1	2.51e-30	132	1230	0.089	0.083	FH14_ARATH Formin-like protein 14 OS=Arabidopsis thaliana OX=3702 GN=FH14 PE=3 SV=3
17	A0A1D5P556	2.36e-29	129	1075	0.109	0.116	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
18	O60610	4.10e-29	128	1272	0.077	0.069	DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2
19	B3DJI0	1.75e-28	126	1069	0.091	0.097	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
20	Q5RHJ3	3.01e-28	125	1079	0.090	0.095	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11215 DUF3010	8.7e+02	11.6	Protein of unknown function (DUF3010)
2	PF02181 FH2	7.2e-95	329.9	Formin Homology 2 Domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427567

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000364883	0.718	Methylglutaconyl-CoA hydratase, mitochondrial
2	9606.ENSP00000362294	0.678	Receptor-type tyrosine-protein phosphatase T
3	9606.ENSP00000400892	0.673	Protein TESPA1
4	9606.ENSP00000361001	0.633	EF-hand calcium-binding domain-containing protein 14
5	9606.ENSP00000479134	0.589	Formin-1
6	9606.ENSP00000378557	0.588	Disheveled-associated activator of morphogenesis 1
7	9606.ENSP00000381876	0.587	Dishevelled associated activator of morphogenesis 2
8	9606.ENSP00000321348	0.584	Protein diaphanous homolog 2
9	9606.ENSP00000335655	0.580	Formin-like protein 3
10	9606.ENSP00000383178	0.579	Protein diaphanous homolog 3
11	9606.ENSP00000381565	0.578	Protein diaphanous homolog 1
12	9606.ENSP00000285735	0.554	Rho-related GTP-binding protein RhoC
13	9606.ENSP00000400175	0.554	Transforming protein RhoA
14	9606.ENSP00000263773	0.552	Formin binding protein 4
15	9606.ENSP00000413625	0.551	Formin-binding protein 1
16	9606.ENSP00000360577	0.548	Enoyl-CoA hydratase domain-containing protein 2, mitochondrial
17	9606.ENSP00000353590	0.526	Myosin-10
18	9606.ENSP00000318884	0.511	Formin-2
19	9606.ENSP00000274458	0.506	COMM domain-containing protein 10
20	9606.ENSP00000355809	0.505	Protein enabled homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0008017	0.996	microtubule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0022607	0.985	cellular component assembly
GO:0120031	0.980	plasma membrane bounded cell projection assembly
GO:0007030	0.977	Golgi organization
GO:0070925	0.942	organelle assembly
GO:0044782	0.932	cilium organization
GO:0060271	0.898	cilium assembly
GO:0007010	0.872	cytoskeleton organization
GO:0030029	0.835	actin filament-based process
GO:0030036	0.727	actin cytoskeleton organization
GO:0097435	0.421	supramolecular fiber organization
GO:0007015	0.303	actin filament organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005874	0.999	microtubule
GO:0005737	0.996	cytoplasm
GO:0043231	0.974	intracellular membrane-bounded organelle
GO:0012505	0.952	endomembrane system
GO:0005829	0.919	cytosol
GO:0120025	0.883	plasma membrane bounded cell projection
GO:0005929	0.429	cilium
GO:0016020	0.425	membrane
GO:0005634	0.407	nucleus
GO:0005794	0.323	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]