StarFunc result for job id Q9C0D7

User Input

>input (883 residues)
MPGGGSQEYGVLCIQEYRKNSKVESSTRNNFMGLKDHLGHDLGHLYVESTDPQLSPAVPW
STVENPSMDTVNVGKDEKEASEENASSGDSEENTNSDHESEQLGSISVEPGLITKTHRQL
CRSPCLEPHILKRNEILQDFKPEESQTTSKEAKKPPDVVREYQTKLEFALKLGYSEEQVQ
LVLNKLGTDALINDILGELVKLGNKSEADQTVSTINTITRETSSLESQRSESPMQEIVTD
DGENLRPIVIDGSNVAMSHGNKEVFSCRGIKLAVDWFLERGHKDITVFVPAWRKEQSRPD
ALITDQEILRKLEKEKILVFTPSRRVQGRRVVCYDDRFIVKLAFESDGIIVSNDNYRDLA
NEKPEWKKFIDERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPIVPEHKKQPCPYGK
KCTYGHKCKYYHPERGSQPQRSVADELRAMSRNTAAKTANEGGLVKSNSVPCSTKADSTS
DVKRGAPKRQSDPSIRTQVYQDLEEKLPTKNKLETRSVPSLVSIPATSTAKPQSTTSLSN
GLPSGVHFPPQDQRPQGQYPSMMMATKNHGTPMPYEQYPKCDSPVDIGYYSMLNAYSNLS
LSGPRSPERRFSLDTDYRISSVASDCSSEGSMSCGSSDSYVGYNDRSYVSSPDPQLEENL
KCQHMHPHSRLNPQPFLQNFHDPLTRGQSYSHEEPKFHHKPPLPHLALHLPHSAVGARSS
CPGDYPSPPSSAHSKAPHLGRSLVATRIDSISDSRLYDSSPSRQRKPYSRQEGLGSWERP
GYGIDAYGYRQTYSLPDNSTQPCYEQFTFQSLPEQQEPAWRIPYCGMPQDPPRYQDNREK
IYINLCNIFPPDLVRIVMKRNPHMTDAQQLAAAILVEKSQLGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0D7	0.999	0.999	0.000	883	1.000	1.000	Q9C0D7.pdb.gz	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
2	AFDB:P20482	0.046	0.038	5.623E-5	1383	0.145	0.093	P20482.pdb.gz	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
3	AFDB:E7F640	0.050	0.050	1.818E-4	866	0.137	0.140	E7F640.pdb.gz	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
4	PDB:5dizA	0.134	0.241	2.128E-4	474	0.027	0.051	5dizA.pdb.gz	Nuclear Protein-Only Ribonuclease P2 Structure and Biochemical Characterization Provide Insight into the Conserved Properties of tRNA 5' End Processing Enzymes.
5	AFDB:Q5EXX3	0.049	0.039	3.270E-4	1203	0.137	0.101	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
6	AFDB:Q7JQG5	0.044	0.043	4.650E-4	924	0.154	0.147	Q7JQG5.pdb.gz	Q7JQG5_DROME Caskin, isoform B OS=Drosophila melanogaster OX=7227 GN=ckn PE=2 SV=1
7	AFDB:Q2EI20	0.065	0.065	9.971E-4	855	0.121	0.125	Q2EI20.pdb.gz	REST_DANRE RE1-silencing transcription factor OS=Danio rerio OX=7955 GN=rest PE=2 SV=1
8	PDB:7onuE	0.131	0.236	1.312E-3	467	0.029	0.056	7onuE.pdb.gz	Structural basis of RNA processing by human mitochondrial RNase P.
9	AFDB:Q9ULK2	0.046	0.047	1.504E-3	861	0.145	0.149	Q9ULK2.pdb.gz	AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=3
10	AFDB:A0A0R4INF0	0.046	0.036	1.902E-3	1570	0.130	0.073	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
11	AFDB:O16117	0.046	0.047	2.868E-3	844	0.136	0.142	O16117.pdb.gz	O16117_DROME Shaven, isoform A OS=Drosophila melanogaster OX=7227 GN=sv PE=2 SV=1
12	AFDB:Q86Y26	0.044	0.037	3.225E-3	1132	0.179	0.140	Q86Y26.pdb.gz	NUTM1_HUMAN NUT family member 1 OS=Homo sapiens OX=9606 GN=NUTM1 PE=1 SV=2
13	PDB:3ivtB	0.074	0.124	1.841E-2	400	0.025	0.055	3ivtB.pdb.gz	Crystal structure and functional analysis of homocitrate synthase, an essential enzyme in lysine biosynthesis.
14	PDB:7mq8SL	0.112	0.377	5.613E-2	192	0.028	0.130	7mq8SL.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7d5s5K	0.107	0.407	1.204E-1	175	0.028	0.143	7d5s5K.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:2fmtA	0.092	0.221	2.434E-1	314	0.025	0.070	2fmtA.pdb.gz	Crystal structure of methionyl-tRNAfMet transformylase complexed with the initiator formyl-methionyl-tRNAfMet.
17	PDB:6a7vC	0.078	0.371	2.581E-1	139	0.023	0.144	6a7vC.pdb.gz
18	PDB:4gslA	0.089	0.122	3.264E-1	598	0.026	0.038	4gslA.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
19	PDB:2c91A	0.061	0.112	4.642E-1	325	0.033	0.089	2c91A.pdb.gz	Crystal Structure of Mouse Succinic Semialdehyde Reductase Akr7A5: Structural Basis for Substrate Specificity.
20	PDB:7wtbB	0.083	0.065	4.642E-1	1147	0.016	0.012	7wtbB.pdb.gz	Mechanistic insight into allosteric activation of human pyruvate carboxylase by acetyl-CoA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C0D7	0.0	1835	883	1.000	1.000	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
2	Q5D1E7	2.14e-136	421	596	0.231	0.342	ZC12A_MOUSE Endoribonuclease ZC3H12A OS=Mus musculus OX=10090 GN=Zc3h12a PE=1 SV=2
3	Q5D1E8	6.46e-135	417	599	0.234	0.346	ZC12A_HUMAN Endoribonuclease ZC3H12A OS=Homo sapiens OX=9606 GN=ZC3H12A PE=1 SV=1
4	Q8BIY3	2.55e-119	374	533	0.207	0.343	ZC12D_MOUSE Probable ribonuclease ZC3H12D OS=Mus musculus OX=10090 GN=Zc3h12d PE=2 SV=2
5	A2A288	1.90e-117	369	527	0.208	0.349	ZC12D_HUMAN Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3
6	O15037	1.34e-49	189	678	0.112	0.146	KHNYN_HUMAN Protein KHNYN OS=Homo sapiens OX=9606 GN=KHNYN PE=1 SV=3
7	Q6A037	4.72e-49	189	893	0.097	0.096	N4BP1_MOUSE NEDD4-binding protein 1 OS=Mus musculus OX=10090 GN=N4bp1 PE=1 SV=2
8	O75113	1.34e-48	188	896	0.096	0.095	N4BP1_HUMAN NEDD4-binding protein 1 OS=Homo sapiens OX=9606 GN=N4BP1 PE=1 SV=4
9	B7ZBA4	1.33e-36	137	167	0.083	0.437	B7ZBA4_HUMAN Zinc finger CCCH-type containing 12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=1
10	Q38AV1	0.82	35.0	240	0.025	0.092	Q38AV1_TRYB2 PARP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0230 PE=4 SV=1
11	Q80VA0	1.0	35.4	657	0.053	0.072	GALT7_MOUSE N-acetylgalactosaminyltransferase 7 OS=Mus musculus OX=10090 GN=Galnt7 PE=1 SV=2
12	Q23342	3.3	33.5	339	0.044	0.115	Q23342_CAEEL RNase NYN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rde-8 PE=1 SV=2
13	Q9QXP6	3.5	33.5	481	0.029	0.054	MKRN1_MOUSE E3 ubiquitin-protein ligase makorin-1 OS=Mus musculus OX=10090 GN=Mkrn1 PE=1 SV=1
14	Q6NPN3	5.3	33.1	465	0.020	0.039	C3H58_ARATH Zinc finger CCCH domain-containing protein 58 OS=Arabidopsis thaliana OX=3702 GN=At5g18550 PE=2 SV=1
15	F4IUS5	5.7	33.1	457	0.036	0.070	F4IUS5_ARATH Zinc finger nuclease 2 OS=Arabidopsis thaliana OX=3702 GN=ZFN2 PE=1 SV=2
16	Q9V3H9	8.4	32.7	1004	0.012	0.011	Q9V3H9_DROME Zinc finger CCCH domain-containing protein 14 OS=Drosophila melanogaster OX=7227 GN=Nab2 PE=1 SV=1
17	O93248	8.8	32.3	971	0.026	0.024	OPA1_ONCMA Dynamin-like 120 kDa protein, mitochondrial OS=Oncorhynchus masou OX=8020 GN=opa1 PE=2 SV=1
18	A3EWL3	9.2	32.3	1105	0.028	0.023	REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana OX=3702 GN=REV1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12520 DUF3723	6e+02	10.5	Protein of unknown function (DUF3723)
2	PF18561 Regnase_1_C	2.3e-25	99.4	Endoribonuclease Regnase 1/ ZC3H12 C-terminal domain
3	PF11977 RNase_Zc3h12a	1e-63	225.2	Zc3h12a-like Ribonuclease NYN domain
4	PF18039 UBA_6	8.6e-17	72.2	UBA-like domain
5	PF14608 zf-CCCH_2	35	16.4	RNA-binding, Nab2-type zinc finger
6	PF18044 zf-CCCH_4	1.2e+02	13.8	CCCH-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000278590

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000436262	0.738	Kelch repeat and BTB domain containing 3
2	9606.ENSP00000386213	0.715	Myosin-IIIb
3	9606.ENSP00000264784	0.643	Solute carrier family 2, facilitated glucose transporter member 9
4	9606.ENSP00000344488	0.616	Junctophilin-1
5	9606.ENSP00000370372	0.611	Neurolysin, mitochondrial
6	9606.ENSP00000469240	0.505	Charged multivesicular body protein 2a
7	9606.ENSP00000356033	0.504	T-cell activation Rho GTPase-activating protein
8	9606.ENSP00000458715	0.504	Caspase recruitment domain-containing protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.775	heterocyclic compound binding
GO:0097159	0.775	organic cyclic compound binding
GO:0003824	0.773	catalytic activity
GO:0003676	0.668	nucleic acid binding
GO:0003723	0.578	RNA binding
GO:0016787	0.517	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0071704	0.989	organic substance metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0009987	0.987	cellular process
GO:0044238	0.987	primary metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0043170	0.982	macromolecule metabolic process
GO:0044237	0.981	cellular metabolic process
GO:0031323	0.972	regulation of cellular metabolic process
GO:0048518	0.969	positive regulation of biological process
GO:0048583	0.968	regulation of response to stimulus
GO:0010468	0.967	regulation of gene expression
GO:0034641	0.961	cellular nitrogen compound metabolic process
GO:0051252	0.955	regulation of RNA metabolic process
GO:0048522	0.950	positive regulation of cellular process
GO:0048523	0.947	negative regulation of cellular process
GO:0009893	0.942	positive regulation of metabolic process
GO:0050896	0.936	response to stimulus
GO:0001817	0.931	regulation of cytokine production
GO:0009057	0.924	macromolecule catabolic process
GO:0031325	0.912	positive regulation of cellular metabolic process
GO:0051246	0.905	regulation of protein metabolic process
GO:0031329	0.905	regulation of cellular catabolic process
GO:0009892	0.895	negative regulation of metabolic process
GO:0009889	0.888	regulation of biosynthetic process
GO:0010604	0.884	positive regulation of macromolecule metabolic process
GO:0051173	0.881	positive regulation of nitrogen compound metabolic process
GO:0010605	0.872	negative regulation of macromolecule metabolic process
GO:0051172	0.865	negative regulation of nitrogen compound metabolic process
GO:0046483	0.842	heterocycle metabolic process
GO:0010629	0.765	negative regulation of gene expression
GO:0031324	0.741	negative regulation of cellular metabolic process
GO:0031326	0.729	regulation of cellular biosynthetic process
GO:0051248	0.726	negative regulation of protein metabolic process
GO:0010608	0.690	post-transcriptional regulation of gene expression
GO:0010556	0.679	regulation of macromolecule biosynthetic process
GO:0044248	0.667	cellular catabolic process
GO:0009896	0.655	positive regulation of catabolic process
GO:0065008	0.653	regulation of biological quality
GO:0044260	0.635	cellular macromolecule metabolic process
GO:0044265	0.634	cellular macromolecule catabolic process
GO:0046700	0.632	heterocycle catabolic process
GO:0044270	0.631	cellular nitrogen compound catabolic process
GO:0019439	0.628	aromatic compound catabolic process
GO:1901361	0.627	organic cyclic compound catabolic process
GO:0034655	0.610	nucleobase-containing compound catabolic process
GO:0006401	0.587	RNA catabolic process
GO:0031331	0.562	positive regulation of cellular catabolic process
GO:0061013	0.556	regulation of mRNA catabolic process
GO:0043487	0.555	regulation of RNA stability
GO:0043488	0.554	regulation of mRNA stability
GO:0061014	0.552	positive regulation of mRNA catabolic process
GO:0017148	0.545	negative regulation of translation
GO:0051241	0.531	negative regulation of multicellular organismal process
GO:0061157	0.508	mRNA destabilization
GO:0002682	0.495	regulation of immune system process
GO:0031399	0.484	regulation of protein modification process
GO:0002376	0.470	immune system process
GO:0051716	0.436	cellular response to stimulus
GO:1902531	0.432	regulation of intracellular signal transduction
GO:0002683	0.426	negative regulation of immune system process
GO:0002694	0.426	regulation of leukocyte activation
GO:0023052	0.405	signaling
GO:0007154	0.403	cell communication
GO:0007165	0.387	signal transduction
GO:1901564	0.386	organonitrogen compound metabolic process
GO:0001818	0.360	negative regulation of cytokine production
GO:0002695	0.347	negative regulation of leukocyte activation
GO:0019538	0.330	protein metabolic process
GO:1903506	0.308	regulation of nucleic acid-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.995	membrane
GO:0005634	0.983	nucleus
GO:0005829	0.978	cytosol
GO:0070013	0.969	intracellular organelle lumen
GO:0031981	0.960	nuclear lumen
GO:0005654	0.906	nucleoplasm
GO:0043228	0.877	non-membrane-bounded organelle
GO:0043232	0.872	intracellular non-membrane-bounded organelle
GO:0012505	0.797	endomembrane system
GO:0005886	0.746	plasma membrane
GO:0032991	0.413	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.517	Hydrolases.

[back to server]