StarFunc result for job id Q9C0E2

User Input

>input (1151 residues)
MMAAALGPPEVIAQLENAAKVLMAPPSMVNNEQRQHAEHIFLSFRKSKSPFAVCKHILET
SKVDYVLFQAATAIMEAVVREWILLEKGSIESLRTFLLTYVLQRPNLQKYVREQILLAVA
VIVKRGSLDKSIDCKSIFHEVSQLISSGNPTVQTLACSILTALLSEFSSSSKTSNIGLSM
EFHGNCKRVFQEEDLRQIFMLTVEVLQEFSRRENLNAQMSSVFQRYLALANQVLSWNFLP
PNLGRHYIAMFESSQNVLLKPTESWRETLLDSRVMELFFTVHRKIREDSDMAQDSLQCLA
QLASLHGPIFPDEGSQVDYLAHFIEGLLNTINGIEIEDSEAVGISSIISNLITVFPRNVL
TAIPSELFSSFVNCLTHLTCSFGRSAALEEVLDKDDMVYMEAYDKLLESWLTLVQDDKHF
HKGFFTQHAVQVFNSYIQCHLAAPDGTRNLTANGVASREEEEISELQEDDRDQFSDQLAS
VGMLGRIAAEHCIPLLTSLLEERVTRLHGQLQRHQQQLLASPGSSTVDNKMLDDLYEDIH
WLILVTGYLLADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGYNR
TDSVIRLLSAILRVSEVESRAIRADLTHLLSPQMGKDIVWFLKRWAKTYLLVDEKLYDQI
SLPFSTAFGADTEGSQWIIGYLLQKVISNLSVWSSEQDLANDTVQLLVTLVERRERANLV
IQCENWWNLAKQFASRSPPLNFLSSPVQRTLMKALVLGGFAHMDTETKQQYWTEVLQPLQ
QRFLRVINQENFQQMCQQEEVKQEITATLEALCGIAEATQIDNVAILFNFLMDFLTNCIG
LMEVYKNTPETVNLIIEVFVEVAHKQICYLGESKAMNLYEACLTLLQVYSKNNLGRQRID
VTAEEEQYQDLLLIMELLTNLLSKEFIDFSDTDEVFRGHEPGQAANRSVSAADVVLYGVN
LILPLMSQDLLKFPTLCNQYYKLITFICEIFPEKIPQLPEDLFKSLMYSLELGMTSMSSE
VCQLCLEALTPLAEQCAKAQETDSPLFLATRHFLKLVFDMLVLQKHNTEMTTAAGEAFYT
LVCLHQAEYSELVETLLSSQQDPVIYQRLADAFNKLTASSTPPTLDRKQKMAFLKSLEEF
MANVGGLLCVK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0E2	1.000	1.000	0.000	1151	1.000	1.000	Q9C0E2.pdb.gz	XPO4_HUMAN Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=2
2	AFDB:Q9EPK7	0.665	0.699	3.647E-26	1087	0.175	0.186	Q9EPK7.pdb.gz	XPO7_MOUSE Exportin-7 OS=Mus musculus OX=10090 GN=Xpo7 PE=1 SV=3
3	AFDB:Q99NF8	0.659	0.692	4.965E-25	1088	0.177	0.188	Q99NF8.pdb.gz	RBP17_MOUSE Ran-binding protein 17 OS=Mus musculus OX=10090 GN=Ranbp17 PE=1 SV=1
4	AFDB:Q38FR1	0.584	0.613	2.370E-16	1088	0.133	0.141	Q38FR1.pdb.gz	Q38FR1_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1250 PE=3 SV=1
5	AFDB:Q924Z6	0.603	0.615	6.222E-14	1125	0.141	0.144	Q924Z6.pdb.gz	XPO6_MOUSE Exportin-6 OS=Mus musculus OX=10090 GN=Xpo6 PE=1 SV=2
6	AFDB:F4IZR5	0.568	0.601	1.831E-13	1076	0.133	0.142	F4IZR5.pdb.gz	XPO1B_ARATH Protein EXPORTIN 1B OS=Arabidopsis thaliana OX=3702 GN=XPO1B PE=2 SV=1
7	AFDB:F1Q9F5	0.518	0.607	1.379E-12	953	0.133	0.161	F1Q9F5.pdb.gz	F1Q9F5_DANRE Importin-13 OS=Danio rerio OX=7955 GN=ipo13 PE=1 SV=2
8	PDB:5uwuC	0.577	0.652	2.602E-12	998	0.127	0.146	5uwuC.pdb.gz	Nuclear export receptor CRM1 recognizes diverse conformations in nuclear export signals.
9	PDB:2xwuB	0.432	0.510	3.560E-12	910	0.134	0.169	2xwuB.pdb.gz
10	AFDB:O94829	0.505	0.583	5.552E-12	963	0.140	0.167	O94829.pdb.gz	IPO13_HUMAN Importin-13 OS=Homo sapiens OX=9606 GN=IPO13 PE=1 SV=3
11	PDB:3wyfC	0.557	0.607	6.662E-12	1040	0.131	0.145	3wyfC.pdb.gz	Structural insights into how yrb2p accelerates the assembly of the xpo1p nuclear export complex
12	AFDB:Q9SMV6	0.583	0.618	1.751E-11	1075	0.124	0.133	Q9SMV6.pdb.gz	XPO1A_ARATH Protein EXPORTIN 1A OS=Arabidopsis thaliana OX=3702 GN=XPO1 PE=1 SV=1
13	AFDB:Q9VEC5	0.422	0.480	1.944E-11	971	0.115	0.136	Q9VEC5.pdb.gz	Q9VEC5_DROME Importin-13 OS=Drosophila melanogaster OX=7227 GN=cdm PE=1 SV=1
14	PDB:6gx9A	0.458	0.552	4.680E-11	912	0.114	0.144	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
15	PDB:4c0qA	0.478	0.595	5.171E-10	871	0.110	0.146	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
16	PDB:2x1gF	0.503	0.614	3.053E-9	896	0.115	0.147	2x1gF.pdb.gz
17	PDB:3gjxA	0.577	0.629	3.389E-9	1041	0.130	0.144	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
18	PDB:6xu2A	0.236	0.246	2.934E-8	1091	0.141	0.148	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
19	PDB:3icqT	0.402	0.465	3.744E-8	949	0.111	0.135	3icqT.pdb.gz	Structures of the tRNA export factor in the nuclear and cytosolic states
20	PDB:3gb8A	0.509	0.595	1.358E-7	958	0.109	0.132	3gb8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0VG75	0.0	2322	1124	0.977	1.000	Q0VG75_HUMAN Exportin 4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=1
2	Q9C0E2	0.0	2376	1151	1.000	1.000	XPO4_HUMAN Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=2
3	Q9EPK7	3.28e-15	83.6	1087	0.068	0.072	XPO7_MOUSE Exportin-7 OS=Mus musculus OX=10090 GN=Xpo7 PE=1 SV=3
4	Q9UIA9	3.57e-15	83.2	1087	0.068	0.072	XPO7_HUMAN Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3
5	Q99NF8	5.66e-09	63.2	1088	0.061	0.064	RBP17_MOUSE Ran-binding protein 17 OS=Mus musculus OX=10090 GN=Ranbp17 PE=1 SV=1
6	A0A0C4DGA6	0.14	38.9	1008	0.020	0.023	A0A0C4DGA6_HUMAN Helicase like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=1
7	Q14527	0.14	38.9	1009	0.020	0.023	HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2
8	Q6PCN7	1.1	35.8	1003	0.018	0.021	HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus OX=10090 GN=Hltf PE=1 SV=1
9	Q5T4S7	1.2	35.8	5183	0.024	0.005	UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1
10	A4ZGQ8	1.9	34.7	326	0.038	0.135	HMT1_BRAOT Homocysteine S-methyltransferase 1 OS=Brassica oleracea var. italica OX=36774 GN=HMT1 PE=1 SV=1
11	Q924Z6	3.0	34.7	1125	0.023	0.023	XPO6_MOUSE Exportin-6 OS=Mus musculus OX=10090 GN=Xpo6 PE=1 SV=2
12	Q96QU8	3.7	34.3	1125	0.023	0.023	XPO6_HUMAN Exportin-6 OS=Homo sapiens OX=9606 GN=XPO6 PE=1 SV=1
13	P78527	8.0	33.1	4128	0.029	0.008	PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3
14	Q8QGX4	8.6	33.1	4134	0.048	0.013	PRKDC_CHICK DNA-dependent protein kinase catalytic subunit OS=Gallus gallus OX=9031 GN=PRKDC PE=2 SV=1
15	P97313	9.5	33.1	4128	0.044	0.012	PRKDC_MOUSE DNA-dependent protein kinase catalytic subunit OS=Mus musculus OX=10090 GN=Prkdc PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08767 CRM1_C	0.27	22.0	CRM1 C terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000255305

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336702	0.919	Eukaryotic translation initiation factor 5A-1
2	9606.ENSP00000327821	0.913	Exportin-T
3	9606.ENSP00000361418	0.854	Importin-13
4	9606.ENSP00000323588	0.846	Transcription factor SOX-2
5	9606.ENSP00000315644	0.789	Thymidylate synthase
6	9606.ENSP00000302790	0.787	Exportin-6
7	9606.ENSP00000356515	0.765	Utrophin
8	9606.ENSP00000262982	0.763	Exportin-2
9	9606.ENSP00000384863	0.739	Exportin-1
10	9606.ENSP00000295822	0.723	Eukaryotic translation initiation factor 5A-2
11	9606.ENSP00000446215	0.714	GTP-binding nuclear protein Ran
12	9606.ENSP00000386992	0.695	Importin-11
13	9606.ENSP00000401470	0.678	Ran GTPase-activating protein 1
14	9606.ENSP00000396896	0.674	DnaJ heat shock protein family member C4
15	9606.ENSP00000265388	0.654	Transportin-3
16	9606.ENSP00000265351	0.639	Exportin-5
17	9606.ENSP00000420306	0.637	THO complex subunit 5 homolog
18	9606.ENSP00000354742	0.630	Importin-9
19	9606.ENSP00000281950	0.629	Gem-associated protein 6
20	9606.ENSP00000245838	0.628	THO complex subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005049	1.000	nuclear export signal receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0032386	0.976	regulation of intracellular transport
GO:0032880	0.971	regulation of protein localization
GO:0048522	0.969	positive regulation of cellular process
GO:0070201	0.954	regulation of establishment of protein localization
GO:0046822	0.929	regulation of nucleocytoplasmic transport
GO:0033157	0.903	regulation of intracellular protein transport
GO:1903829	0.897	positive regulation of protein localization
GO:0032388	0.883	positive regulation of intracellular transport
GO:0090316	0.853	positive regulation of intracellular protein transport
GO:0046825	0.851	regulation of protein export from nucleus
GO:0046824	0.789	positive regulation of nucleocytoplasmic transport
GO:0009987	0.724	cellular process
GO:0006913	0.318	nucleocytoplasmic transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.972	protein-containing complex
GO:0012505	0.771	endomembrane system
GO:0005635	0.662	nuclear envelope
GO:0140513	0.590	nuclear protein-containing complex
GO:0005643	0.479	nuclear pore
GO:0031074	0.396	nucleocytoplasmic transport complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]