StarFunc result for job id Q9C0E4

User Input

>input (1043 residues)
MLCGLSRETPGEADDGPYSKGGKDAGGADVSLACRRQSIPEEFRGITVVELIKKEGSTLG
LTISGGTDKDGKPRVSNLRPGGLAARSDLLNIGDYIRSVNGIHLTRLRHDEIITLLKNVG
ERVVLEVEYELPPPAPENNPRIISKTVDVSLYKEGNSFGFVLRGGAHEDGHKSRPLVLTY
VRPGGPADREGSLKVGDRLLSVDGIPLHGASHATALATLRQCSHEALFQVEYDVATPDTV
ANASGPLMVEIVKTPGSALGISLTTTSLRNKSVITIDRIKPASVVDRSGALHPGDHILSI
DGTSMEHCSLLEATKLLASISEKVRLEILPVPQSQRPLRPSEAVKVQRSEQLHRWDPCVP
SCHSPRPGHCRMPTWATPAGQDQSRSLSSTPFSSPTLNHAFSCNNPSTLPRGSQPMSPRT
TMGRRRQRRREHKSSLSLASSTVGPGGQIVHTETTEVVLCGDPLSGFGLQLQGGIFATET
LSSPPLVCFIEPDSPAERCGLLQVGDRVLSINGIATEDGTMEEANQLLRDAALAHKVVLE
VEFDVAESVIPSSGTFHVKLPKKRSVELGITISSASRKRGEPLIISDIKKGSVAHRTGTL
EPGDKLLAIDNIRLDNCPMEDAVQILRQCEDLVKLKIRKDEDNSDELETTGAVSYTVELK
RYGGPLGITISGTEEPFDPIVISGLTKRGLAERTGAIHVGDRILAINNVSLKGRPLSEAI
HLLQVAGETVTLKIKKQLDRPLLPRKSGSLSETSDADEDPADALKGGLPAARFSPAVPSV
DSAVESWDSSATEGGFGGPGSYTPQAAARGTTPQERRPGWLRGSPPPTEPRRTSYTPTPA
DESFPEEEEEDDWEPPTSPAPGPAREEGFWRMFGEALEDLESCGQSELLRELEASIMTGT
VQRVALEGRPGHRPWQRGREVRASPAEMEELLLPTPLEMHKVTLHKDPMRHDFGFSVSDG
LLEKGVYVHTVRPDGPAHRGGLQPFDRVLQVNHVRTRDFDCCLAVPLLAEAGDVLELIIS
RKPHTAHSSRAPRSPGPSSPRML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8E0R9	0.539	0.521	0.000	1083	0.690	0.665	A8E0R9.pdb.gz	GRIP2_XENLA Glutamate receptor-interacting protein 2 OS=Xenopus laevis OX=8355 GN=grip2 PE=2 SV=2
2	AFDB:E0CXS4	0.442	0.457	0.000	1001	0.843	0.878	E0CXS4.pdb.gz	E0CXS4_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
3	AFDB:Q9C0E4	1.000	1.000	0.000	1043	1.000	1.000	Q9C0E4.pdb.gz	GRIP2_HUMAN Glutamate receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=GRIP2 PE=1 SV=4
4	AFDB:Q9WTW1	0.561	0.561	0.000	1043	0.873	0.873	Q9WTW1.pdb.gz	GRIP2_RAT Glutamate receptor-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Grip2 PE=1 SV=1
5	AFDB:Q7KRY7	0.160	0.104	5.049E-25	1851	0.186	0.105	Q7KRY7.pdb.gz	SCRIB_DROME Protein lap4 OS=Drosophila melanogaster OX=7227 GN=scrib PE=1 SV=1
6	AFDB:Q9W2L2	0.095	0.083	1.749E-21	1202	0.154	0.134	Q9W2L2.pdb.gz	Q9W2L2_DROME LD27118p OS=Drosophila melanogaster OX=7227 GN=Magi PE=1 SV=2
7	AFDB:A0A0R4IZU1	0.092	0.073	6.715E-18	1347	0.146	0.113	A0A0R4IZU1.pdb.gz
8	AFDB:O97758	0.104	0.069	1.034E-16	1769	0.168	0.099	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
9	PDB:2xkxA	0.091	0.127	1.796E-14	721	0.075	0.108	2xkxA.pdb.gz
10	AFDB:E0CYS1	0.087	0.500	8.892E-14	174	0.105	0.626	E0CYS1.pdb.gz	E0CYS1_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
11	AFDB:Q13424	0.083	0.169	1.245E-6	505	0.061	0.127	Q13424.pdb.gz	SNTA1_HUMAN Alpha-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTA1 PE=1 SV=1
12	PDB:7pc3A	0.081	0.204	3.149E-6	405	0.027	0.069	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7qqmA	0.083	0.207	3.870E-6	413	0.031	0.077	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:7p73A	0.082	0.200	4.291E-6	420	0.024	0.060	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
15	PDB:7p70A	0.083	0.207	8.835E-6	407	0.029	0.074	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
16	PDB:6pcvA	0.112	0.144	1.204E-5	754	0.035	0.048	6pcvA.pdb.gz
17	PDB:7qqnC	0.081	0.197	1.915E-5	414	0.029	0.072	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:3pv2B	0.065	0.141	4.847E-5	388	0.040	0.108	3pv2B.pdb.gz
19	PDB:6t36A	0.081	0.827	6.273E-5	93	0.018	0.204	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
20	PDB:7pe9I	0.078	0.247	1.051E-4	317	0.024	0.079	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8E0R9	0.0	1426	1083	0.693	0.668	GRIP2_XENLA Glutamate receptor-interacting protein 2 OS=Xenopus laevis OX=8355 GN=grip2 PE=2 SV=2
2	B0V3R3	0.0	733	736	0.380	0.538	B0V3R3_DANRE Glutamate receptor interacting protein 2 OS=Danio rerio OX=7955 GN=fi03h07 PE=4 SV=1
3	E0CXE0	0.0	1432	821	0.698	0.887	E0CXE0_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
4	E0CXS4	0.0	1718	1001	0.844	0.879	E0CXS4_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
5	G3XA20	0.0	1808	1042	0.875	0.876	G3XA20_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
6	P97879	0.0	1189	1112	0.608	0.570	GRIP1_RAT Glutamate receptor-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Grip1 PE=1 SV=1
7	Q499W6	0.0	1026	591	0.501	0.885	Q499W6_MOUSE Grip2 protein (Fragment) OS=Mus musculus OX=10090 GN=Grip2 PE=2 SV=1
8	Q925T6	0.0	1200	1127	0.611	0.565	GRIP1_MOUSE Glutamate receptor-interacting protein 1 OS=Mus musculus OX=10090 GN=Grip1 PE=1 SV=1
9	Q9C0E4	0.0	2102	1043	1.000	1.000	GRIP2_HUMAN Glutamate receptor-interacting protein 2 OS=Homo sapiens OX=9606 GN=GRIP2 PE=1 SV=4
10	Q9WTW1	0.0	1805	1043	0.873	0.873	GRIP2_RAT Glutamate receptor-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Grip2 PE=1 SV=1
11	Q9Y3R0	0.0	1191	1128	0.610	0.564	GRIP1_HUMAN Glutamate receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=GRIP1 PE=1 SV=3
12	E0CYS1	2.65e-64	217	174	0.104	0.621	E0CYS1_MOUSE Glutamate receptor interacting protein 2 OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
13	F7BQ55	5.97e-43	154	119	0.072	0.630	F7BQ55_MOUSE Glutamate receptor interacting protein 2 (Fragment) OS=Mus musculus OX=10090 GN=Grip2 PE=1 SV=1
14	X2JIJ6	7.94e-30	130	1057	0.087	0.086	X2JIJ6_DROME Glutamate receptor interacting protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Grip PE=4 SV=1
15	Q8SY14	1.24e-28	126	1058	0.087	0.086	Q8SY14_DROME RE14068p OS=Drosophila melanogaster OX=7227 GN=Grip PE=2 SV=1
16	Q9W450	1.28e-28	126	1058	0.087	0.086	Q9W450_DROME FI03335p OS=Drosophila melanogaster OX=7227 GN=Grip PE=1 SV=2
17	Q8VBX6	7.49e-18	92.0	2055	0.146	0.074	MPDZ_MOUSE Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2
18	Q63ZW7	4.66e-17	89.4	1834	0.137	0.078	INADL_MOUSE InaD-like protein OS=Mus musculus OX=10090 GN=Patj PE=1 SV=2
19	O75970	1.14e-16	88.2	2070	0.147	0.074	MPDZ_HUMAN Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2
20	O55164	7.13e-16	85.5	2054	0.147	0.074	MPDZ_RAT Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	0.049	24.4	Family of unknown function (DUF6288)
2	PF04495 GRASP55_65	0.08	24.7	GRASP55/65 PDZ-like domain
3	PF02391 MoaE	7.3e+02	11.8	MoaE protein
4	PF00595 PDZ	4.9e-88	300.9	PDZ domain
5	PF13180 PDZ_2	2.3e-31	119.3	PDZ domain
6	PF17820 PDZ_6	2.2e-59	208.5	PDZ domain
7	PF02163 Peptidase_M50	7.9e-19	79.7	Peptidase family M50
8	PF14685 Tricorn_PDZ	0.00013	33.2	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480660

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296526	0.993	Glutamate receptor 2
2	9606.ENSP00000385205	0.973	PRKCA-binding protein
3	9606.ENSP00000481554	0.964	Glutamate receptor 3
4	9606.ENSP00000428994	0.955	Glutamate receptor 1
5	9606.ENSP00000282499	0.954	Glutamate receptor 4
6	9606.ENSP00000381293	0.929	Vesicle-fusing ATPase
7	9606.ENSP00000263431	0.917	Protein kinase C gamma type
8	9606.ENSP00000408695	0.917	Protein kinase C alpha type
9	9606.ENSP00000381098	0.916	Glutamate receptor-interacting protein 1
10	9606.ENSP00000305355	0.915	Protein kinase C beta type
11	9606.ENSP00000482835	0.906	AP-2 complex subunit beta
12	9606.ENSP00000367743	0.904	Tetraspanin-7
13	9606.ENSP00000327694	0.903	AP-2 complex subunit alpha-2
14	9606.ENSP00000351926	0.903	AP-2 complex subunit alpha-1
15	9606.ENSP00000292807	0.902	AP-2 complex subunit mu
16	9606.ENSP00000263270	0.900	AP-2 complex subunit sigma
17	9606.ENSP00000312506	0.888	Chondroitin sulfate proteoglycan 4
18	9606.ENSP00000365606	0.801	GRIP1-associated protein 1
19	9606.ENSP00000239032	0.743	Prolactin-releasing peptide receptor
20	9606.ENSP00000286827	0.661	T-lymphoma invasion and metastasis-inducing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035254	0.395	glutamate receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.996	biological regulation
GO:0099072	0.993	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0097120	0.993	receptor localization to synapse
GO:0032456	0.993	endocytic recycling
GO:0035296	0.992	regulation of tube diameter
GO:0045777	0.992	positive regulation of blood pressure
GO:0062237	0.992	protein localization to postsynapse
GO:0050794	0.991	regulation of cellular process
GO:1990778	0.991	protein localization to cell periphery
GO:0072657	0.991	protein localization to membrane
GO:0023052	0.986	signaling
GO:0007154	0.986	cell communication
GO:0051716	0.980	cellular response to stimulus
GO:0099003	0.972	vesicle-mediated transport in synapse
GO:0007219	0.970	Notch signaling pathway
GO:0003018	0.968	vascular process in circulatory system
GO:1903539	0.968	protein localization to postsynaptic membrane
GO:0061951	0.968	establishment of protein localization to plasma membrane
GO:0003012	0.965	muscle system process
GO:0042310	0.964	vasoconstriction
GO:0006939	0.856	smooth muscle contraction
GO:0015031	0.823	protein transport
GO:0006886	0.466	intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0071944	0.987	cell periphery
GO:0005737	0.980	cytoplasm
GO:0016020	0.977	membrane
GO:0005886	0.970	plasma membrane
GO:0030054	0.967	cell junction
GO:0005829	0.902	cytosol
GO:0043226	0.880	organelle
GO:0045202	0.869	synapse
GO:0043229	0.796	intracellular organelle
GO:0043231	0.764	intracellular membrane-bounded organelle
GO:0098978	0.759	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]