StarFunc result for job id Q9C0F0

User Input

>input (2248 residues)
MKDKRKKKDRTWAEAARLALEKHPNSPMTAKQILEVIQKEGLKETSGTSPLACLNAMLHT
NTRIGDGTFFKIPGKSGLYALKKEESSCPADGTLDLVCESELDGTDMAEANAHGEENGVC
SKQVTDEASSTRDSSLTNTAVQSKLVSSFQQHTKKALKQALRQQQKRRNGVSMMVNKTVP
RVVLTPLKVSDEQSDSPSGSESKNGEADSSDKEMKHGQKSPTGKQTSQHLKRLKKSGLGH
LKWTKAEDIDIETPGSILVNTNLRALINKHTFASLPQHFQQYLLLLLPEVDRQMGSDGIL
RLSTSALNNEFFAYAAQGWKQRLAEGEFTPEMQLRIRQEIEKEKKTEPWKEKFFERFYGE
KLGMSREESVKLTTGPNNAGAQSSSSCGTSGLPVSAQTALAEQQPKSMKSPASPEPGFCA
TLCPMVEIPPKDIMAELESEDILIPEESVIQEEIAEEVETSICECQDENHKTIPEFSEEA
ESLTNSHEEPQIAPPEDNLESCVMMNDVLETLPHIEVKIEGKSESPQEEMTVVIDQLEVC
DSLIPSTSSMTHVSDTEHKESETAVETSTPKIKTGSSSLEGQFPNEGIAIDMELQSDPEE
QLSENACISETSFSSESPEGACTSLPSPGGETQSTSEESCTPASLETTFCSEVSSTENTD
KYNQRNSTDENFHASLMSEISPISTSPEISEASLMSNLPLTSEASPVSNLPLTSETSPMS
DLPLTSETSSVSSMLLTSETTFVSSLPLPSETSPISNSSINERMAHQQRKSPSVSEEPLS
PQKDESSATAKPLGENLTSQQKNLSNTPEPIIMSSSSIAPEAFPSEDLHNKTLSQQTCKS
HVDTEKPYPASIPELASTEMIKVKNHSVLQRTEKKVLPSPLELSVFSEGTDNKGNELPSA
KLQDKQYISSVDKAPFSEGSRNKTHKQGSTQSRLETSHTSKSSEPSKSPDGIRNESRDSE
ISKRKTAEQHSFGICKEKRARIEDDQSTRNISSSSPPEKEQPPREEPRVPPLKIQLSKIG
PPFIIKSQPVSKPESRASTSTSVSGGRNTGARTLADIKARAQQARAQREAAAAAAVAAAA
SIVSGAMGSPGEGGKTRTLAHIKEQTKAKLFAKHQARAHLFQTSKETRLPPPLSSKEGPP
NLEVSSTPETKMEGSTGVIIVNPNCRSPSNKSAHLRETTTVLQQSLNPSKLPETATDLSV
HSSDENIPVSHLSEKIVSSTSSENSSVPMLFNKNSVPVSVCSTAISGAIKEHPFVSSVDK
SSVLMSVDSANTTISACNISMLKTIQGTDTPCIAIIPKCIESTPISATTEGSSISSSMDD
KQLLISSSSASNLVSTQYTSVPTPSIGNNLPNLSTSSVLIPPMGINNRFPSEKIAIPGSE
EQATVSMGTTVRAALSCSDSVAVTDSLVAHPTVAMFTGNMLTINSYDSPPKLSAESLDKN
SGPRNRADNSGKPQQPPGGFAPAAINRSIPCKVIVDHSTTLTSSLSLTVSVESSEASLDL
QGRPVRTEASVQPVACPQVSVISRPEPVANEGIDHSSTFIAASAAKQDSKTLPATCTSLR
ELPLVPDKLNEPTAPSHNFAEQARGPAPFKSEADTTCSNQYNPSNRICWNDDGMRSTGQP
LVTHSGSSKQKEYLEQSCPKAIKTEHANYLNVSELHPRNLVTNVALPVKSELHEADKGFR
MDTEDFPGPELPPPAAEGASSVQQTQNMKASTSSPMEEAISLATDALKRVPGAGSSGCRL
SSVEANNPLVTQLLQGNLPLEKVLPQPRLGAKLEINRLPLPLQTTSVGKTAPERNVEIPP
SSPNPDGKGYLAGTLAPLQMRKRENHPKKRVARTVGEHTQVKCEPGKLLVEPDVKGVPCV
ISSGISQLGHSQPFKQEWLNKHSMQNRIVHSPEVKQQKRLLPSCSFQQNLFHVDKNGGFH
TDAGTSHRQQFYQMPVAARGPIPTAALLQASSKTPVGCNAFAFNRHLEQKGLGEVSLSSA
PHQLRLANMLSPNMPMKEGDEVGGTAHTMPNKALVHPPPPPPPPPPPPLALPPPPPPPPP
LPPPLPNAEVPSDQKQPPVTMETTKRLSWPQSTGICSNIKSEPLSFEEGLSSSCELGMKQ
VSYDQNEMKEQLKAFALKSADFSSYLLSEPQKPFTQLAAQKMQVQQQQQLCGNYPTIHFG
STSFKRAASAIEKSIGILGSGSNPATGLSGQNAQMPVQNFADSSNADELELKCSCRLKAM
IVCKGCGAFCHDDCIGPSKLCVACLVVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9C0F0	0.999	0.999	0.000	2248	1.000	1.000	Q9C0F0.pdb.gz	ASXL3_HUMAN Putative Polycomb group protein ASXL3 OS=Homo sapiens OX=9606 GN=ASXL3 PE=2 SV=3
2	AFDB:Q8IXJ9	0.094	0.127	2.411E-32	1541	0.220	0.321	Q8IXJ9.pdb.gz	ASXL1_HUMAN Polycomb group protein ASXL1 OS=Homo sapiens OX=9606 GN=ASXL1 PE=1 SV=4
3	AFDB:P59598	0.095	0.130	7.193E-32	1514	0.216	0.320	P59598.pdb.gz	ASXL1_MOUSE Polycomb group protein ASXL1 OS=Mus musculus OX=10090 GN=Asxl1 PE=1 SV=1
4	AFDB:Q76L83	0.082	0.117	4.725E-31	1435	0.162	0.254	Q76L83.pdb.gz	ASXL2_HUMAN Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
5	AFDB:Q8BZ32	0.076	0.118	5.413E-28	1370	0.151	0.247	Q8BZ32.pdb.gz	ASXL2_MOUSE Putative Polycomb group protein ASXL2 OS=Mus musculus OX=10090 GN=Asxl2 PE=1 SV=1
6	AFDB:A0A0G2JU33	0.081	0.113	2.470E-27	1493	0.203	0.306	A0A0G2JU33.pdb.gz	A0A0G2JU33_RAT ASXL transcriptional regulator 1 OS=Rattus norvegicus OX=10116 GN=Asxl1 PE=3 SV=2
7	AFDB:D3Z8N9	0.062	0.109	1.250E-17	1225	0.122	0.224	D3Z8N9.pdb.gz	D3Z8N9_RAT ASXL transcriptional regulator 2 OS=Rattus norvegicus OX=10116 GN=Asxl2 PE=3 SV=4
8	AFDB:A8JR05	0.027	0.026	2.454E-3	2351	0.117	0.112	A8JR05.pdb.gz	A8JR05_DROME Crossveinless c, isoform C OS=Drosophila melanogaster OX=7227 GN=cv-c PE=4 SV=1
9	AFDB:P21263	0.026	0.029	5.742E-3	1893	0.083	0.099	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
10	AFDB:Q96M83	0.029	0.041	1.264E-2	1385	0.067	0.109	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
11	PDB:7vo0G	0.025	0.323	2.504	131	0.004	0.069	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
12	PDB:4uslA	0.020	0.179	4.070	173	0.004	0.046	4uslA.pdb.gz	Structural Basis of Sorcin-Mediated Calcium-Dependent Signal Transduction.
13	PDB:7m6aA	0.017	0.010	4.595	4306	0.005	0.003	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
14	PDB:7n98A	0.017	0.056	4.595	473	0.004	0.017	7n98A.pdb.gz
15	PDB:6h1cB	0.016	0.197	5.189	134	0.003	0.052	6h1cB.pdb.gz	Ferric uptake regulator with Mn and Zn form Pseudomonas aeruginosa
16	PDB:2g9wA	0.016	0.237	6.225	119	0.004	0.067	2g9wA.pdb.gz
17	PDB:7qcdD	0.017	0.090	6.225	326	0.004	0.028	7qcdD.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
18	PDB:5c0xK	0.013	0.068	6.615	350	0.005	0.031	5c0xK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
19	PDB:2zdiB	0.020	0.211	7.029	106	0.004	0.075	2zdiB.pdb.gz
20	PDB:2zhgA	0.022	0.171	7.469	121	0.007	0.124	2zhgA.pdb.gz	Crystal structure of the [2Fe-2S] oxidative-stress sensor SoxR bound to DNA

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9C0F0	0.0	4573	2248	1.000	1.000	ASXL3_HUMAN Putative Polycomb group protein ASXL3 OS=Homo sapiens OX=9606 GN=ASXL3 PE=2 SV=3
2	Q8IXJ9	6.93e-91	330	1541	0.084	0.123	ASXL1_HUMAN Polycomb group protein ASXL1 OS=Homo sapiens OX=9606 GN=ASXL1 PE=1 SV=4
3	P59598	2.07e-85	313	1514	0.085	0.126	ASXL1_MOUSE Polycomb group protein ASXL1 OS=Mus musculus OX=10090 GN=Asxl1 PE=1 SV=1
4	A0A0G2JU33	9.41e-62	236	1448	0.052	0.080	A0A0G2JU33_RAT ASXL transcriptional regulator 1 OS=Rattus norvegicus OX=10116 GN=Asxl1 PE=3 SV=2
5	A0A5F9ZHN2	2.09e-60	220	526	0.045	0.194	A0A5F9ZHN2_HUMAN ASXL transcriptional regulator 2 (Fragment) OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
6	E7EWD6	1.29e-57	223	1434	0.048	0.075	E7EWD6_HUMAN ASXL transcriptional regulator 2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=2
7	Q76L83	1.36e-57	223	1435	0.048	0.075	ASXL2_HUMAN Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1
8	D3Z8N9	2.13e-56	219	1297	0.062	0.107	D3Z8N9_RAT ASXL transcriptional regulator 2 OS=Rattus norvegicus OX=10116 GN=Asxl2 PE=3 SV=4
9	Q8BZ32	2.39e-55	216	1370	0.044	0.072	ASXL2_MOUSE Putative Polycomb group protein ASXL2 OS=Mus musculus OX=10090 GN=Asxl2 PE=1 SV=1
10	Q9V727	3.53e-31	137	1669	0.031	0.042	ASX_DROME Polycomb protein Asx OS=Drosophila melanogaster OX=7227 GN=Asx PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13919 ASXH	2.7e-30	116.6	Asx homology domain
2	PF05066 HARE-HTH	2.4e-16	71.2	HB1, ASXL, restriction endonuclease HTH domain
3	PF13922 PHD_3	1.2e-17	75.4	PHD domain of transcriptional enhancer, Asx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269197

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417132	0.967	Ubiquitin carboxyl-terminal hydrolase BAP1
2	9606.ENSP00000320147	0.819	Histone-lysine N-methyltransferase EZH2
3	9606.ENSP00000384490	0.747	Chromobox protein homolog 6
4	9606.ENSP00000404658	0.745	Histone-lysine N-methyltransferase EZH1
5	9606.ENSP00000316578	0.734	Polycomb protein SUZ12
6	9606.ENSP00000269385	0.723	Chromobox protein homolog 8
7	9606.ENSP00000251900	0.719	Sex comb on midleg-like protein 2
8	9606.ENSP00000308750	0.717	Chromobox protein homolog 2
9	9606.ENSP00000269397	0.709	E3 SUMO-protein ligase CBX4
10	9606.ENSP00000263360	0.707	Polycomb protein EED
11	9606.ENSP00000216133	0.685	Chromobox protein homolog 7
12	9606.ENSP00000257118	0.684	Polyhomeotic-like protein 2
13	9606.ENSP00000364839	0.683	Putative Polycomb group protein ASXL1
14	9606.ENSP00000383920	0.676	Putative Polycomb group protein ASXL2
15	9606.ENSP00000356480	0.671	E3 ubiquitin-protein ligase RING2
16	9606.ENSP00000363787	0.660	E3 ubiquitin-protein ligase RING1
17	9606.ENSP00000040584	0.653	Homeobox protein Hox-C8
18	9606.ENSP00000360626	0.653	Potassium voltage-gated channel subfamily G member 1
19	9606.ENSP00000420294	0.648	Polyhomeotic-like protein 3
20	9606.ENSP00000440674	0.643	Polyhomeotic-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0042975	0.636	peroxisome proliferator activated receptor binding
GO:0003824	0.519	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009890	0.980	negative regulation of biosynthetic process
GO:0080090	0.936	regulation of primary metabolic process
GO:0019216	0.908	regulation of lipid metabolic process
GO:0050794	0.844	regulation of cellular process
GO:0046890	0.777	regulation of lipid biosynthetic process
GO:0045833	0.773	negative regulation of lipid metabolic process
GO:0060255	0.678	regulation of macromolecule metabolic process
GO:0031323	0.637	regulation of cellular metabolic process
GO:0051055	0.619	negative regulation of lipid biosynthetic process
GO:0051171	0.567	regulation of nitrogen compound metabolic process
GO:0010468	0.560	regulation of gene expression
GO:0031326	0.550	regulation of cellular biosynthetic process
GO:1903506	0.505	regulation of nucleic acid-templated transcription
GO:0006355	0.503	regulation of DNA-templated transcription
GO:0009987	0.496	cellular process
GO:0048518	0.329	positive regulation of biological process
GO:0048523	0.328	negative regulation of cellular process
GO:0010605	0.303	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0140513	0.924	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]